View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson census
From: DAN MILNER <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 10:33:28 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


No... just the abridgment.  Back when a dollar was a
dollar, I was earning 50 cents.All the best,
Dan Milner--- Paul Garon <[unmask]> wrote:
> At 04:33 PM 8/14/03 -0400, you wrote:
> >edward cray wrote:
> > >
> > > Folks:
> > >
> > > Do any other subscribers have complete sets?
> > >
> > > Ed
>
>
> While I don't own the 4-volume set, I did handle one
> last year. It
> ultimately found a home with a musician in Northern
> Indiana, who isn't a
> member of this list (I'm guessing about that.)
>
> Paul Garon
>
>
> Paul and Beth Garon
> Beasley Books (ABAA)
> 1533 W. Oakdale
> Chicago, IL 60657
> (773) 472-4528
> (773) 472-7857 FAX
> [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson Census
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 10:43:35 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


Folks:Late returns bring the total of complete sets of Bronson cherished by
ballad-l subscribers to 14, or 8.1 percent of the 173 complete sets sold
by Princeton University Press in the late 1960s-early 1970s.Ed

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay List - 08/13/03
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 14:03:10 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(33 lines) , text/html(23 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child, Bronson, Maitland et al
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 14:28:19 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(10 lines) , text/html(8 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Simon Furey <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 20:16:21 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


Quite a few sets must have made it; I can cite at least three I know of
apart from mine - one at Sheffield University, one owned by a friend of mine
in Nottingham and another owned by a friend in Sussex. I still remember him
coming into the Lewes Arms folk club waving volume 4 in glee when it first
came out in the 1970s. I suppose there must be one in the Vaughan Williams
Memorial Library too.
Cheers
Simon
----- Original Message -----
From: "Ruairidh Greig" <[unmask]>
To: <[unmask]>
Sent: Friday, August 15, 2003 1:41 PM
Subject: Bronson Census> I wonder how many sets made it to the UK? I have all four, bought one by
one
> from Blackwells in Oxford in the 1970s.
>
> Ruairidh Greig
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: FYI: Henry Green
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 14:33:45 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


This site summarizes the murder of Mary Ann Wyatt by Henry Green in
Berlin, NY, in 1845.  I mention it because this is not a folklore
site, although a ballad is given.http://www.homestead.com/familyhistories/green.htmlW. K. McNeil has written on this subject (NEW YORK FOLKLORE QUARTERLY
Vol. XXV, No. 1, March, 1969).
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 17:17:40 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(44 lines)


Folks:The more sets we track down, the more interesting does this become.I assume that perhaps half of the complete four-volume sets went to research
libraries: LC, BL, Sheffield, Edinburgh, UCLA, Berkeley, Illinois, White Library
(Cleveland), Harvard, Princeton (of course).  Some libraries, such as UCLA
Special Collections and its general circulation library, probably bought two
copies.The fact remains that one of the principle resources in ballad scholarship is
very narrowly distributed.  As are the people who use this resource.Ed----- Original Message -----
From: Simon Furey <[unmask]>
Date: Friday, August 15, 2003 12:16 pm
Subject: Re: Bronson Census> Quite a few sets must have made it; I can cite at least three I know of
> apart from mine - one at Sheffield University, one owned by a friend of mine
> in Nottingham and another owned by a friend in Sussex. I still remember him
> coming into the Lewes Arms folk club waving volume 4 in glee when it first
> came out in the 1970s. I suppose there must be one in the Vaughan Williams
> Memorial Library too.
> Cheers
> Simon
> ----- Original Message -----
> From: "Ruairidh Greig" <[unmask]>
> To: <[unmask]>
> Sent: Friday, August 15, 2003 1:41 PM
> Subject: Bronson Census
>
>
> > I wonder how many sets made it to the UK? I have all four, bought one by
> one
> > from Blackwells in Oxford in the 1970s.
> >
> > Ruairidh Greig
> >
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Malcolm Douglas <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 02:17:29 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


----- Original Message -----
From: [unmask]
Sent: 15 August 2003 20:16
Subject: Re: [BALLAD-L] Bronson Census> Quite a few sets must have made it; I can cite at least three I know of
> apart from mine - one at Sheffield University, one owned by a friend of mine
> in Nottingham and another owned by a friend in Sussex. I still remember him
> coming into the Lewes Arms folk club waving volume 4 in glee when it first
> came out in the 1970s. I suppose there must be one in the Vaughan Williams
> Memorial Library too.Apart from the Sheffield University set (which I have been gradually photocopying for quite some
time, now: I'm about halfway through at the moment), a friend in Sheffield claims to have a set
bought from a college library (I think he keeps it in a box somewhere; I doubt if it's ever used),
and it's possible that "Doc" Rowe has one, which would likely also be in Sheffield now; though I'm
not sure of that. There certainly is a set at the VWML, and I'd be surprised if there were not one
at Leeds, which had a folklore department in those days.Malcolm Douglas---
Outgoing mail is certified Virus Free.
Checked by AVG anti-virus system (http://www.grisoft.com).
Version: 6.0.504 / Virus Database: 302 - Release Date: 24/07/03

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson
From: Edie Gale Hays <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 23:43:04 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(9 lines)


>Do any other subscribers have complete sets?Yes, but I cheated and xeroxed mine.   It required three different
interlibrary loan sources to acquire the four volumes to copy.EdieEdie Gale Hays
[unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 22:26:49 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


Edie:You must be the fourth or fifth person who has confessed to Xeroxing the four
volumes of Bronson -- a monumental task, to be sure.I suspect you will love, or resent the forthcoming CD reprint of Bronson that
ballad-l list member David Kleiman is preparing for sale.Ed----- Original Message -----
From: Edie Gale Hays <[unmask]>
Date: Friday, August 15, 2003 9:43 pm
Subject: Bronson> >Do any other subscribers have complete sets?
>
> Yes, but I cheated and xeroxed mine.   It required three different
> interlibrary loan sources to acquire the four volumes to copy.
>
> Edie
>
> Edie Gale Hays
> [unmask]
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: PS Books. Conversation with the Blues
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 05:08:35 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(13 lines) , text/html(9 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Paul Garon <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 08:30:57 -0300
Content-Type:text/plain
Parts/Attachments:

text/plain(32 lines)


>    It required three different
>interlibrary loan sources to acquire the four volumes to copy.
>
>EdieThis reminded me to look at OCLC. No, no, no, don't everybody jump on me at
once! I know its weaknesses are legion, but I'm surprised to find that you
had difficulty finding interlibrary loan sources when in fact OCLC
registers 800+ copies of this 4-volume set.Obviously, many libraries signed on to this description when they actually
only had a volume or two, but even if 1/5 of them were true....I gather that many of you are in academia--and I am not--so you probably
have more hands-on experience with OCLC than I do. I am a member of the
Antiquarian Booksellers Association of America and the ABAA subscribes to
OCLC for its members.Or, if I'm getting way too many false positives with my search, maybe
someone could tell me how to do it right?Paul GaronPaul and Beth Garon
Beasley Books (ABAA)
1533 W. Oakdale
Chicago, IL 60657
(773) 472-4528
(773) 472-7857 FAX
[unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 10:29:35 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(27 lines) , text/html(19 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson Owners
From: Mary Stafford <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 15 Aug 2003 09:06:53 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(3 lines)


I have all four volumes, bought as they were published. I also have the complete 3-book set of Child from Cooper Square, bought second hand years ago.Mary Stafford

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Edie Gale Hays <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 10:16:05 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


>I suspect you will love, or resent the forthcoming CD reprint of Bronson that
>ballad-l list member David Kleiman is preparing for sale.I will love it. CDs are far more transportable than four large heavy
notebooks.Edie

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Paul Garon <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 10:47:06 -0300
Content-Type:text/plain
Parts/Attachments:

text/plain(51 lines)


OCLC stands for something like Online Computer Library Center, and it can
be used as *sort* of a National Union Catalog, although it is not as
participated in as thoroughly as the NUC and it has (apparently) a great
many cataloging errors in it. Still, it's very helpful to find out when a
book was first published, details about the publisher, etc, and how rare it
is (relatively speaking).Unfortunately, it is only available by subscription, usually to libraries
who provide its services to their users. It might be something libraries in
the UK have, but I just don't know. (My knowledge of library science is
entirely from the perspectives of a user and of a subscriber to PROGRESSIVE
LIBRARIAN.)Paul GaronAt 10:29 AM 8/16/03 -0400, you wrote:
>Paul Garon wrote:-
>
>> >This reminded me to look at OCLC. No, no, no, don't everybody jump on
>> me at
>>once! I know its weaknesses are legion, but I'm surprised to find that you
>>had difficulty finding interlibrary loan sources when in fact OCLC
>>registers 800+ copies of this 4-volume set.
>>
>>I hate to show my ignorance, but what is OCLC ? Is it something limited
>>to the USA ? I ask because I order quite a lot of stuff by interlibrary
>>loan, and I deal with a small branch library, whose staff get very
>>confused very easily.
>
>
>If I could direct them to specific sources, it would make life a lot
>easier for them as well as for me.
>
>I still remember the time when I ordered Cecil Sharp's English Folksongs
> From The Southern Appalachians. They came back almost immediately with a
>copy of Maud Karpeles' 80 English Folksongs From The Southern Appalachians
>and the assistant was adamant that she'd got the right book ! Yes, I
>swiped a photocopy, when I eventually managed to persuade them to order
>the one I'd asked for.
>
>Cheers,
>
>Fred McCormickPaul and Beth Garon
Beasley Books (ABAA)
1533 W. Oakdale
Chicago, IL 60657
(773) 472-4528
(773) 472-7857 FAX
[unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Lewis Becker <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 12:22:59 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Ed,I suppose that compiling statistics re partial sets would extend your
inquiry far beyond its original purposes but it might be interesting. I
have volumes 1-3, lacking the elusive volume 4.  I bought volume 1 from
a bookdealer who had beat me out to a house sale. I got to the house
sale late because the newspaper I relied on had somehow listed the wrong
time (his newspaper had the right time). When I later went to the
dealer's shop, he sold me volume 1, which he had got at the house sale.
The price was $25 and the copy was - and is - beautiful in a beautiful
dust jacket. I also bought from him the 3 volume Child reprint published
by Folklore Associates, which he had also purchased at the house sale,
also in dust jacket.  The price was $50 for the set. Considering that he
must have made a considerable profit on the sale to me, I can only
imagine what he paid.  I got volume 2 of Bronson at a book fair at the
end of the day for $28.  No one wanted it for $35, the original asking
price.Lew Becker>>> [unmask] 8/15/2003 1:43:35 PM >>>
Folks:Late returns bring the total of complete sets of Bronson cherished by
ballad-l subscribers to 14, or 8.1 percent of the 173 complete sets
sold
by Princeton University Press in the late 1960s-early 1970s.Ed

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 09:34:01 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


Edie:Yeah, but then you need something to "play" the CDs on.Ed----- Original Message -----
From: Edie Gale Hays <[unmask]>
Date: Saturday, August 16, 2003 8:16 am
Subject: Re: Bronson> >I suspect you will love, or resent the forthcoming CD reprint of Bronson that
> >ballad-l list member David Kleiman is preparing for sale.
>
> I will love it. CDs are far more transportable than four large heavy
> notebooks.
>
> Edie
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Cal & Lani Herrmann <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 11:07:00 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


On Sat, Aug 16, 2003 at 08:30:57AM -0300, Paul Garon wrote:> This reminded me to look at OCLC. No, no, no, don't everybody jump on me at
> once! I know its weaknesses are legion, but I'm surprised to find that you
> had difficulty finding interlibrary loan sources when in fact OCLC
> registers 800+ copies of this 4-volume set.
>
> Obviously, many libraries signed on to this description when they actually
> only had a volume or two, but even if 1/5 of them were true....        'At's funny, I was about to suggest that someone (with more direct access
to Librarianly resources than I do) check the OCLC database for other copies.
This can count as 'I-almost-told-you-so,' I guess.  -- Aloha, Lani<||> Lani Herrmann * [unmask] (or: [unmask])
<||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Margaret MacArthur <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 14:10:46 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


In answer to Ed Cray, I have all 4 volumes of Bronson, having inherited
1,2and 3 from the Flanders estate, and been given 4 by John Roberts in
exchange for a complete Child, an inherited duplicate of a set I ownedMargaret MacArthur
Box 15 MacArthur Road
Marlboro VT 05344
802/254/2549
[unmask]
http://www.margaretmacarthur.com
from the heart of the Green Mountains

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson census
From: Becky Nankivell <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 11:22:00 -0600
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


The University of Arizona music library has a set. Unfortunately, there
are restrictions on who can check them out (i.e., not mere un-affiliated
townies like myself), and someone has the set checked out pretty much in
perpetuity, so I can't even look at them on-site. The library can't
reveal the identity of this unknown scholar, of course...According to their on-line catalog, Arizona State has them, too, but
they're currently  at the bindery. (?!?)I did find volume 2 at a local used bookstore (with no identifying marks
as to the previous owner).~ Becky Nankivell
Tucson, Arizona> Date:    Fri, 15 Aug 2003 17:17:40 -0700
> From:    edward cray <[unmask]>
> Subject: Re: Bronson Census
>
> Folks:
>
> The more sets we track down, the more interesting does this become.
>
> I assume that perhaps half of the complete four-volume sets went to research
> libraries: LC, BL, Sheffield, Edinburgh, UCLA, Berkeley, Illinois, White Library
> (Cleveland), Harvard, Princeton (of course).  Some libraries, such as UCLA
> Special Collections and its general circulation library, probably bought two
> copies.
>
> The fact remains that one of the principle resources in ballad scholarship is
> very narrowly distributed.  As are the people who use this resource.
>
> Ed
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 14:23:08 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(38 lines) , text/html(32 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 14:58:50 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(10 lines) , text/html(7 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson
From: George Madaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 15:00:09 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


     I checked the Boston College holdings and came up with the
following:Bronson, Bertrand Harris, 1902-
Title   The traditional tunes of the Child ballads;  with their texts,
according to the extant records of Great Britain and America.
Imprint Princeton, N.J.,  Princeton University Press,  1959-72.
Descr.  4 v. music. 29 cm.
General Note    Each ballad preceded by historical notes.
Contents        v. 1. Ballads 1 to 53.--v. 2. Ballads 54 to 113.--v. 3.
Ballads 114 to 243.--v. 4. Ballads 245-299, with addenda to volumes 1-4.George F. Madaus
Boisi Professor of Education and Public Policy
Senior Research Fellow
National Board on Educational Testing and Public Policy
Center for the Study of Testing Evaluation and Educational Policy
Carolyn A. and Peter S. Lynch School of Education
Boston College
Chestnut Hill MA 02467
[unmask]
617. 552.4521
617 552 8419 FAX

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Edie Gale Hays <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 16:53:29 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(5 lines)


>Yeah, but then you need something to "play" the CDs on.Have laptop computer (complete with CD burner and DVD player), will travel.Edie

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 16 Aug 2003 21:30:33 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(64 lines)


I don't consider myself narrowly distributed.
Norm----- Original Message -----
From: "edward cray" <[unmask]>
To: <[unmask]>
Sent: Friday, August 15, 2003 5:17 PM
Subject: Re: Bronson Census> Folks:
>
> The more sets we track down, the more interesting does this become.
>
> I assume that perhaps half of the complete four-volume sets went to
research
> libraries: LC, BL, Sheffield, Edinburgh, UCLA, Berkeley, Illinois, White
Library
> (Cleveland), Harvard, Princeton (of course).  Some libraries, such as UCLA
> Special Collections and its general circulation library, probably bought
two
> copies.
>
> The fact remains that one of the principle resources in ballad scholarship
is
> very narrowly distributed.  As are the people who use this resource.
>
> Ed
>
> ----- Original Message -----
> From: Simon Furey <[unmask]>
> Date: Friday, August 15, 2003 12:16 pm
> Subject: Re: Bronson Census
>
> > Quite a few sets must have made it; I can cite at least three I know of
> > apart from mine - one at Sheffield University, one owned by a friend of
mine
> > in Nottingham and another owned by a friend in Sussex. I still remember
him
> > coming into the Lewes Arms folk club waving volume 4 in glee when it
first
> > came out in the 1970s. I suppose there must be one in the Vaughan
Williams
> > Memorial Library too.
> > Cheers
> > Simon
> > ----- Original Message -----
> > From: "Ruairidh Greig" <[unmask]>
> > To: <[unmask]>
> > Sent: Friday, August 15, 2003 1:41 PM
> > Subject: Bronson Census
> >
> >
> > > I wonder how many sets made it to the UK? I have all four, bought one
by
> > one
> > > from Blackwells in Oxford in the 1970s.
> > >
> > > Ruairidh Greig
> > >
> >
> >
> >
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson for sale
From: Paul Garon <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 17 Aug 2003 08:09:40 -0300
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


HiI don't know whether this is a single volume or a one-volume abridgement or
what, but it just popped up on abebooks.com, if anyone is interested.
----------------
1. The Traditional tunes of the Child ballads : with their texts, according
to the extant records of Great Britain and America. by Bronson, Bertrand
Harris. Page Collector Reprints 1959 New facsimile reproduction of original
edition, quality hardback
The price of the book is US$ 79.00 Hardbound quality facsimile reproduction
of out-of-print titles
  Please reference the seller's book # PC081406060 when ordering.To order this book click here:
http://dogbert.abebooks.com/abe/BookDetails?ph=1&bi=227320708The seller is PageCollector
Beverly Hills, CA, U.S.A..
<mailto:[unmask]>
Terms of sale: New book, Replica edition printed on demand, hardbound
Typically ships within a few business days.
------------
Paul GaronPaul and Beth Garon
Beasley Books (ABAA)
1533 W. Oakdale
Chicago, IL 60657
(773) 472-4528
(773) 472-7857 FAX
[unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Adam Miller <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 17 Aug 2003 07:17:46 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(6 lines)


Dear Readers,I guess I missed this part of the discussion:  what will the 4 Bronson
volumes on CD-ROM retail for?-Adam Miller

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: John Roberts <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 17 Aug 2003 11:17:32 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


I don't believe this has been announced. Though as I understand it
the plan is to bring it out within the next 12 months, there are
still a number of uncrossed bridges over this river, and getting the
original Child up and marketed must be one of them.John Roberts>Dear Readers,
>
>I guess I missed this part of the discussion:  what will the 4 Bronson
>volumes on CD-ROM retail for?
>
>-Adam Miller

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Barbara Boock <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 09:10:55 +0200
Content-Type:text/plain
Parts/Attachments:

text/plain(60 lines)


Dear all,
Deutsches Volksliedarchiv Freiburg has all four volumes too and a lot of
research material for international folksong-research.
Yours Barbara Boock, librarian
At 17:17 15.08.2003 -0700, you wrote:
>Folks:
>
>The more sets we track down, the more interesting does this become.
>
>I assume that perhaps half of the complete four-volume sets went to research
>libraries: LC, BL, Sheffield, Edinburgh, UCLA, Berkeley, Illinois, White
>Library
>(Cleveland), Harvard, Princeton (of course).  Some libraries, such as UCLA
>Special Collections and its general circulation library, probably bought two
>copies.
>
>The fact remains that one of the principle resources in ballad scholarship is
>very narrowly distributed.  As are the people who use this resource.
>
>Ed
>
>----- Original Message -----
>From: Simon Furey <[unmask]>
>Date: Friday, August 15, 2003 12:16 pm
>Subject: Re: Bronson Census
>
> > Quite a few sets must have made it; I can cite at least three I know of
> > apart from mine - one at Sheffield University, one owned by a friend of
> mine
> > in Nottingham and another owned by a friend in Sussex. I still remember him
> > coming into the Lewes Arms folk club waving volume 4 in glee when it first
> > came out in the 1970s. I suppose there must be one in the Vaughan Williams
> > Memorial Library too.
> > Cheers
> > Simon
> > ----- Original Message -----
> > From: "Ruairidh Greig" <[unmask]>
> > To: <[unmask]>
> > Sent: Friday, August 15, 2003 1:41 PM
> > Subject: Bronson Census
> >
> >
> > > I wonder how many sets made it to the UK? I have all four, bought one by
> > one
> > > from Blackwells in Oxford in the 1970s.
> > >
> > > Ruairidh Greig
> > >
> >
> >
> >Barbara Boock, Bibliothekarin
Deutsches Volksliedarchiv
Arbeitsstelle für internationale Volksliedforschung
Silberbachstr. 13
79100 Freiburg
Tel 0761/7050314
Fax 0761/7050328
http://www.dva.uni-freiburg.de/

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Some Bright Day
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 14:29:23 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(15 lines) , text/html(9 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 14:48:10 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(19 lines) , text/html(10 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 14:54:08 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(7 lines) , text/html(5 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 15:34:00 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


[unmask] wrote:
>
> There is a set at the University of Ulster at Coleraine and - apart
> from Fred McCormick - I am the only person who has borrowed it in
> about twenty years - that's another kind of thinness.
>
> John MouldenI got my set of 4 volumes about 2 years ago, for $500.00. They were in
like new condition (but no dust jackets), and in fact, I found no
evidence that any volume had been previously opened.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at Bruce Olson's website <A
href="http://www.erols.com/olsonw"> Click </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Subject: Re: Some Bright Day
From: John Roberts <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 15:46:19 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(46 lines)


Spiritual, but not "a" spiritual, at least in my book. This is the
entry for The Lass of Roch Royal. The particular version (Appendix C,
p.271) begins:I wish I was in my own room
A-sitting on a bed of down
I never would give to you my hand
To sail to a foreign landHush oh hush my dearest
I hate to hear you cry
The best of friends do part
And why not you and IThere are 13 verses, Who will shoe/ + standard floating verses - the
title reference (v.9) is:And if ever I prove false to the one I love
Bright day will surely turn to night
My own true love
Bright day will turn to nightIf you should need the complete text I'll scan it.John Roberts____________I am trying to trace a spiritual, possibly of white origin called
Some Bright Day, and have a version in front of me which was
collected by Cortez D Reece in West Virginia. Roud has an entry for a
song called Bright Day, which is in Davis, Traditional Ballads of
Virginia pp.260-277, recorded from a Mrs Maxie of Altavista, in 1914
(28 Feb). Roud 6868.I want to check whether this is the same song, but I don't have a
copy of Davis and there is no way I can lay my hands on one. Is there
any kind soul out there who might have a set of the words.Many anticipatory thanks,Fred McCormick.

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bronson and OCLC
From: Susan Lawlor <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 16:46:08 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(54 lines)


Hello list,I'm coming out of the lurking mode that I've been in since I joined this
list last year, because this is the first time I felt I actually had some
information to contribute, namely about the lack of volume level holdings
information in OCLC.Admittedly one of the gaps in OCLC's functions is the ability to search
multi-volume sets at the holdings (or individual volume) level.  While this
level of searching is available for periodicals, there isn't any way for
libraries to enter that sort of data when we're cataloging books.  So the
only way to find this out is to search the libraries individual catalogs,
which fortunately are becoming more and more accessible through the
internet.  I've worked out a relatively efficient process for doing this
(note that I said "relatively," it still takes a little time).1. You'll still need to do an Worldcat search, or have some friendly
librarian do it for you, and get the holdings listing.  One of the beauties
of Worldcat (as compared to the old style OCLC) is that when it tells you
what libraries have a particular book, it gives the whole name and location
of the library (not just those scrummy little three letter codes).While we're on the subject, there is a similar (though much smaller) entity
in the UK, COPAC http://copac.ac.uk/about.html  which offers a union catalog
of the Consortium of University Research Libraries. COPAC which includes the
holdings of the British Library, which OCLC does not. And even better, COPAC
is a free service, so you don't have to find a member library to get access
to it.2. Once you have the your list, got to this site at Berkeley: Libweb
http://sunsite.berkeley.edu/Libweb/  it currently lists websites for 6600
libraries in 115 countries, divided into categories (public, academic,
school, etc.)  You can also do a keyword search with location=yourstate,
this will give you a list of all the libraries (academic, public, etc)
together. Hint: Use MS Internet Explorer as your browser, the keyword search
results will not come up in Netscape.3. Then you can search the catalogs of each library on your Worldcat or
COPAC list, and most of the time you'll be able to see which individual
volumes the library has. As a trial I went through this process to see which
libraries in Virginia had all four volumes of Bronson.  Worldcat listed 21
libraries in Virginia that owned it.  By copying and pasting the title, this
search took me about 15 minutes and the results were: 9 libraries with all
four volumes; 8 with one, two, or three volumes; and 4 where it was
impossible to determine.  These last four were all catalogs that do not
allow holdings level information to users off-site (nothing's perfect).Back to lurk mode....Susan Lawlor, Technical Services Librarian
Thomas Nelson Community College * Hampton, VA
email: [unmask]
Voice: (757) 825-3530 * Fax: (757) 825-2870

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Some Bright Day
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 14:35:43 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(32 lines)


Fred:The Davis reference is not correct.  (Nor is it in his "More Traditional
Ballads...")  There is no "Bright Day" or "Some Bright Day" there.I checked the George Pullen Jackson indecies for both "Some Bright Day" and
"Bright Day," but found nothing.Sorry.Ed----- Original Message -----
From: Fred McCormick <[unmask]>
Date: Monday, August 18, 2003 11:29 am
Subject: Some Bright Day> I am trying to trace a spiritual, possibly of white origin called Some Bright
> Day, and have a version in front of me which was collected by Cortez D Reece
> in West Virginia. Roud has an entry for a song called Bright Day, which is in
> Davis, Traditional Ballads of Virginia pp.260-277, recorded from a Mrs Maxie
> of Altavista, in 1914 (28 Feb). Roud 6868.
>
> I want to check whether this is the same song, but I don't have a copy of
> Davis and there is no way I can lay my hands on one. Is there any kind
> soul out
> there who might have a set of the words.
>
> Many anticipatory thanks,
>
> Fred McCormick.
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson and OCLC
From: Paul Garon <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 17:33:06 -0300
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


At 04:46 PM 8/18/03 -0400, you wrote:
>I'm coming out of the lurking mode that I've been in since I joined this
>list last year, because this is the first time I felt I actually had some
>information to contribute, namely about the lack of volume level holdings
>information in OCLC.   AND MUCH MORE..... snipWow, this was worth the price of admission alone! Many, many thanks! I
always hoped there was something like Libweb out there, and now I have the
address... Cool.Paul GaronPaul and Beth Garon
Beasley Books (ABAA)
1533 W. Oakdale
Chicago, IL 60657
(773) 472-4528
(773) 472-7857 FAX
[unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 23:29:20 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(25 lines)


>> Quite a few sets must have made it; I can cite at least three I know of
>> apart from mine - one at Sheffield University, one owned by a friend of
>> mine in Nottingham and another owned by a friend in Sussex. [...]
>> I suppose there must be one in the Vaughan Williams Memorial Library too.
> Apart from the Sheffield University set[...] a friend in Sheffield claims
> to have a set bought from a college library [...] and it's possible that
> "Doc" Rowe has one, which would likely also be in Sheffield now; though
> I'm not sure of that. There certainly is a set at the VWML, and I'd be
> surprised if there were not one at Leeds, which had a folklore department
> in those days.Two in Edinburgh: one in the music section of the public library and one
in the National Library of Scotland across the road.  Edinburgh University
has the one-volume abridgment in the music department library (which is
about to be closed by the same bean-counting shits who imposed prohibitive
charges on outside users a while back - and the whole department is living
on borrowed time too) and I suspect there may be one in the School of
Scottish Studies library as well (which is doubtless next on the hitlist
once they've got rid of the music department).-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Some Bright Day
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 18:03:37 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(92 lines)


<<I am trying to trace a spiritual, possibly of white origin called Some
Bright
Day, and have a version in front of me which was collected by Cortez D Reece
in West Virginia. Roud has an entry for a song called Bright Day, which is
in
Davis, Traditional Ballads of Virginia pp.260-277, recorded from a Mrs Maxie
of Altavista, in 1914 (28 Feb). Roud 6868.I want to check whether this is the same song, but I don't have a copy of
Davis and there is no way I can lay my hands on one. Is there any kind soul
out
there who might have a set of the words.>>I'm posting this to the list, so that someone else won't go through the
typing. Here are the words to "Bright Day"; it's Appendix C to Davis's #21,
"The Lass of Roch Royal"; punctuation more or less as in the original:"I wish I was in my own room,
A-sitting on a bed of down;
I never would give to you my hand
To sail to a foreign land.""Hush, oh hus, my dearest,
I hate to hear you cry,
The best of friends do part,
And why not you and I?"Oh, don't you see yonder lonesome dove,
Flying from pine to pine,
Mourning for its own true love,
Just like I have mourned for mine."Oh, I wish to the Lord I'd never been born,
Or had died when I was young,
I'd never been here to shed a tear
For no girl under the sun."Oh, who will shoe your pretty little foot?
And who will glove your hand?
And who will kiss your rosy red lips
When I'm in some foreign land?""My father will shoe my feet, my love;
My mother will glove my hand;
And you may kiss my rosy red lips
If you ever return again.""Supposing I go so far away,
Be taken sick and die;
Who will hear me when I cry (pray)
And who will see me when I die?""Oh, if you go so far away,
Be taken sick and die,
Your father will hear you when you cry (pray)
Your mother will see you when you die.""And if ever I prove false to the one I love,
Bright day will surely turn to night,
My own true love,
Bright day will turn to night. *"Oh, I wish to the Lord I'd never been born,
Or had died when I was young,
I'd never been here to shed a tear
For no girl under the sun."That for me the cradle had never been rocked,
Nor to me my mother sung,
Then would I have not been here
To part from you, my dear. *"Oh, if ever I prove false
To you, my own true love,
Bright day will turn to night,
And the raging sea shall burn;
If I false prove to the one I love,
The elements shall mourn. *"Oh, if I had never been born,
Or had died when I was young,
I'd never been here to shed a tear
For no girl under the sun."Davis notes that in the stanzas marked by asterisks (*), the line divisions
are doubtful.It doesn't sound much like a spiritual to me.Peace,
Paul

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson and OCLC
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 19:06:36 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(30 lines)


Paul Garon wrote:
>
> At 04:46 PM 8/18/03 -0400, you wrote:
> >I'm coming out of the lurking mode that I've been in since I joined this
> >list last year, because this is the first time I felt I actually had some
> >information to contribute, namely about the lack of volume level holdings
> >information in OCLC.   AND MUCH MORE..... snip
>
> Wow, this was worth the price of admission alone! Many, many thanks! I
> always hoped there was something like Libweb out there, and now I have the
> address... Cool.
>
> Paul Garon
>
> Paul and Beth Garon
> Beasley Books (ABAA)
> 1533 W. Oakdale
> Chicago, IL 60657
> (773) 472-4528
> (773) 472-7857 FAX
> [unmask]Seconded!Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at Bruce Olson's website <A
href="http://www.erols.com/olsonw"> Click </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Some Bright Day
From: Susan Friedman <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 19:43:47 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(29 lines) , text/html(31 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Truman and Suzanne Price <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 16:31:43 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


>>
>> The more sets we track down, the more interesting does this become.
>>
>> I assume that perhaps half of the complete four-volume sets went to research
>> libraries: LC, BL, Sheffield, Edinburgh, UCLA, Berkeley, Illinois, White
>> LibraryThis listing from WorldCat may be of interest:The traditional tunes of the Child ballads; with their texts, according to
the extant records of Great Britain and America.
             Author: Bronson, Bertrand Harris, Child, Francis James,
             Publication: Princeton, N.J., Princeton University Press, 1959
             OCLC member libraries worldwide: 797 (i.e., 797 copies are in OCLC member libraries)Truman--
Suzanne and Truman Price
Columbia Basin Books
7210 Helmick Road
Monmouth, OR 97361Folk music a specialtyemail [unmask]
phone 503-838-5452
abe URL: http://dogbert.abebooks.com/abep/il.dll?vci=3381
also 10,000 childrens books at http:/www.oldchildrensbooks.com
Truman's music: http:/www.oldchildrensbooks.com/musicmember PAUBA Portland Area Used Booksellers Association

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 18:17:48 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(57 lines)


Truman:If I may beg to differ, I would point out that while Princeton may have sold 797
of volume 1, thus beginning the OCLC listing, the fact is that the press sold
just 173 copies of volume 4.  I guessed that about half of that 173 went to
libraries and half to individuals.As I interpret the returns, it suggests that the community of serious ballad
scholars is rather small.  It is almost astounding that 16 subscribers to
ballad-l own an ESTIMATED 18.5 percent of the complete four-volume sets not in
libraries.Ed----- Original Message -----
From: Truman and Suzanne Price <[unmask]>
Date: Monday, August 18, 2003 4:31 pm
Subject: Re: Bronson Census> >>
> >> The more sets we track down, the more interesting does this become.
> >>
> >> I assume that perhaps half of the complete four-volume sets went to
> research>> libraries: LC, BL, Sheffield, Edinburgh, UCLA, Berkeley,
> Illinois, White
> >> Library
>
> This listing from WorldCat may be of interest:
>
> The traditional tunes of the Child ballads; with their texts, according to
> the extant records of Great Britain and America.
>             Author: Bronson, Bertrand Harris, Child, Francis James,
>             Publication: Princeton, N.J., Princeton University Press, 1959
>             OCLC member libraries worldwide: 797
>
> (i.e., 797 copies are in OCLC member libraries)
>
> Truman
>
> --
> Suzanne and Truman Price
> Columbia Basin Books
> 7210 Helmick Road
> Monmouth, OR 97361
>
> Folk music a specialty
>
> email [unmask]
> phone 503-838-5452
> abe URL: http://dogbert.abebooks.com/abep/il.dll?vci=3381
> also 10,000 childrens books at http:/www.oldchildrensbooks.com
> Truman's music: http:/www.oldchildrensbooks.com/music
>
> member PAUBA Portland Area Used Booksellers Association
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: Malcolm Douglas <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 02:58:11 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(25 lines)


----- Original Message -----
From: "edward cray" <[unmask]>
To: <[unmask]>
Sent: 19 August 2003 02:17
Subject: Re: [BALLAD-L] Bronson Census> Truman:
>
> If I may beg to differ, I would point out that while Princeton may have sold 797
> of volume 1, thus beginning the OCLC listing, the fact is that the press sold
> just 173 copies of volume 4.  I guessed that about half of that 173 went to
> libraries and half to individuals.Do we know how many were actually printed, though? Presumably bulk remainders wouldn't have been
included in that figure; or would they?Malcolm Douglas---
Outgoing mail is certified Virus Free.
Checked by AVG anti-virus system (http://www.grisoft.com).
Version: 6.0.504 / Virus Database: 302 - Release Date: 24/07/03

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson Census
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 18 Aug 2003 22:42:55 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(53 lines)


Malcolm:I must defer to David Kleiman who first gave me the figure for the sales of the
fourth volume: 173.  Princeton may have remaindered some -- 173 does seem like
an odd press run -- but it would not be many copies.I cite Kleiman as an authority because he has optioned and is preparing a CD
reprint of Bronson's four volumes.  I understand he has just a year to get them
into print, which same is great news for all those who have long sought to own a
complete set.EdP.S.  David, if you are back on line, will you please formally announce this set.
And do explain about midi or whatever musical files you will incorporate, etc.----- Original Message -----
From: Malcolm Douglas <[unmask]>
Date: Monday, August 18, 2003 6:58 pm
Subject: Re: Bronson Census> ----- Original Message -----
> From: "edward cray" <[unmask]>
> To: <[unmask]>
> Sent: 19 August 2003 02:17
> Subject: Re: [BALLAD-L] Bronson Census
>
>
> > Truman:
> >
> > If I may beg to differ, I would point out that while Princeton may have
> sold 797
> > of volume 1, thus beginning the OCLC listing, the fact is that the press
> sold> just 173 copies of volume 4.  I guessed that about half of that 173
> went to
> > libraries and half to individuals.
>
>
> Do we know how many were actually printed, though? Presumably bulk
> remainders wouldn't have been
> included in that figure; or would they?
>
> Malcolm Douglas
>
>
> ---
> Outgoing mail is certified Virus Free.
> Checked by AVG anti-virus system (http://www.grisoft.com).
> Version: 6.0.504 / Virus Database: 302 - Release Date: 24/07/03
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bronson
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 04:50:26 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(19 lines) , text/html(12 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Some Bright Day
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 04:50:37 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(120 lines) , text/html(110 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Some Bright Day
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 04:50:59 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(52 lines) , text/html(47 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Some Bright Day
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 11:17:25 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(15 lines) , text/html(8 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: More on Bronson
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 09:00:22 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


Folks:I am posting this message for David Kleiman, who has optioned from
Princeton University Press the four-volume Bronson.  It was David who
passed on the information that just 173 copies of Volume 4 were sold.Ed
------------------------------------------------------------------------Hi Ed,Just thought this might help...the 173 number came directly from the
contracts and rights management office at Princeton University Press.
Unfortunately, their older records are not available and they moved their
offices on campus within the last year so a lot of their papers are
currently
sitting in warehouses.Given the active discussion thread, and my own interests, I emailed my
contacts there to see if they can pin down a number on the actual press
run.
I already know that: a. they do not have a list of sales made in the past;
and b. they do not even maintain an archival copy.  I'll let you know if I
get anything else out of them.I wonder if Lanni Hermann would have any other information or insights?Best,
DMK
> David:
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Ebay List - 08/19/03
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 16:07:17 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(67 lines)


Hi!        The list is short this week. There was a definite decrease in
new items during the power outage.        SONGSTERS        2187790052 - Jessie Norton's Songster, date unknown, $9.99 (ends
Aug-20-03 19:15:55 PDT)        SONGBOOKS. ETC.        2551338120 - Bawdy Ballads by Cray, 1978, 1 GBP w/reserve (e
SONGSTERS        2187790052 - Jessie Norton's Songster, date unknown, $9.99 (ends
Aug-20-03 19:15:55 PDT)        SONGBOOKS. ETC.        2551338120 - Bawdy Ballads by Cray, 1978, 1 GBP w/reserve (ends
Aug-20-03 00:25:04 PDT)        3544396555 - Robin Hood, 2volumes, 1795, $175 (ends Aug-20-03
07:41:21 PDT)        3544457123 - Traditional British Ballads by Whiting, 1955, $3.99
(ends Aug-20-03 13:11:40 PDT)        3544575940 - Danish Emigrant Ballads and Songs by Wright, 1983,
$9.99 (ends Aug-21-03 06:29:19 PDT)        2551568537 - Cowboy Jamboree Western Songs&Lore by Felton, 1951,
$8 (ends Aug-21-03 08:27:54 PDT)        3544726570 - AN AMERICAN GARLAND : Being A Collection of Ballads
Relating to America 1563-1759 by Firth, 1969 reissue, $9.99 (ends
Aug-21-03 20:30:41 PDT)        3545018797 - JOURNAL OF APPALACHIAN STUDIES, Spring 1996, $4.25
(ends Aug-23-03 15:57:40 PDT)        3545195570 - English Minstrelsie, 1896, $2 (ends Aug-24-03
12:19:02 PDT)        2552380149 - Oahu Folio of Mountain Songs and Priaire Ballads
for Hawaiian Guitar, 1935, $3.50 (ends Aug-25-03 14:49:09 PDT)        3342329875 - 4 Old Mountain music songbooks, $3.99 (ends
Aug-25-03 15:00:00 PDT)        2552015701 - THE ENGLISH BALLAD by Gundry, 1995, $5 (ends
Aug-26-03 19:24:57 PDT)        There are also two live auctions which feature single sheet
broadsides. These close on the 24th and are quite expensive. If anyone
wants the auction numbers, I will be glad to email to individuals or the
group.                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay List - 08/19/03
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 14:10:35 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


Guys:Do NOT buy that first edition of "The Erotic Muse," reprinted in Great Britain
as  "Bawdy Ballads." The second edition is far superior, and is available in
hardcover or paper from U of Illinois Press.Furthermore, this was a pirated edition -- one of more than a few I have turned
up.  As I don't have a copy of it, I will splurge for $1.65.Ed----- Original Message -----
From: Dolores Nichols <[unmask]>
Date: Tuesday, August 19, 2003 1:07 pm
Subject: Ebay List - 08/19/03> Hi!
>
>        The list is short this week. There was a definite decrease in
> new items during the power outage.
>
>        SONGSTERS
>
>        2187790052 - Jessie Norton's Songster, date unknown, $9.99 (ends
> Aug-20-03 19:15:55 PDT)
>
>        SONGBOOKS. ETC.
>
>        2551338120 - Bawdy Ballads by Cray, 1978, 1 GBP w/reserve (e
> SONGSTERS
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Shaggy Dogs
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 17:53:59 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(46 lines)


Folks:I know, it's an old joke, but just in case one of the younger
subscribers hasn't heard this one (as forwarded by my daughter):An Irish Frog goes into a bank and approaches the teller. He can see
from her nameplate that her name is Patricia Whack. "Miss Whack, I'd
like to get a $30,000 loan to take a holiday." Patty looks at the frog
in disbelief and asks his name. The frog says his name is Kermit Jagger,
his dad is Mick Jagger, and that it's okay, he knows the bank manager.Patty explains that he will need to secure the loan with some collateral
The frog says, "Sure. I have this," and produces a tiny porcelain
elephant, about half an inch tall - bright pink and perfectly formed.
Very confused, Patty explains that she'll have to consult with the bank
manager and disappears into a back office. She finds the manager and
says, "There's a frog called Kermit Jagger out there who claims to know
you and wants to borrow $30,000, and he wants to use this as
collateral." She holds up the tiny pink elephant. "I mean, what in the
world is this?"(you're gonna love this)(its a real treat)(masterpiece)(wait for it)The bank manager looks back at her and says..."It's a knickknack, Patty Whack. Give the frog a
loan. His old man's a Rolling Stone."(You're singing it, aren't you?!!)Ed Cray

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 21:25:34 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(15 lines)


edward cray wrote:
>
> "It's a knickknack, Patty Whack. Give the frog a
> loan. His old man's a Rolling Stone."
>
> (You're singing it, aren't you?!!)
>
> Ed CrayHow am I ever going to remember the real words after that?
Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at Bruce Olson's website <A
href="http://www.erols.com/olsonw"> Click </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 21:04:38 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(37 lines)


On 8/19/03, edward cray wrote:>Folks:
>
>I know, it's an old joke, but just in case one of the younger
>subscribers hasn't heard this one (as forwarded by my daughter):
>
>An Irish Frog goes into a bank and approaches the teller. He can see
>from her nameplate that her name is Patricia Whack. "Miss Whack, I'd
>like to get a $30,000 loan to take a holiday." Patty looks at the frog
>in disbelief and asks his name. The frog says his name is Kermit Jagger,
>his dad is Mick Jagger, and that it's okay, he knows the bank manager.
>
>Patty explains that he will need to secure the loan with some collateral
>The frog says, "Sure. I have this," and produces a tiny porcelain
>elephant, about half an inch tall - bright pink and perfectly formed.
>Very confused, Patty explains that she'll have to consult with the bank
>manager and disappears into a back office. She finds the manager and
>says, "There's a frog called Kermit Jagger out there who claims to know
>you and wants to borrow $30,000, and he wants to use this as
>collateral." She holds up the tiny pink elephant. "I mean, what in the
>world is this?"Just to show that there is folk processing out there still, the
person I heard this from had some detail about how the frog
was descended from Kermit of the Muppets as well as from Mick
Jagger. Details I can't recall. The rest of the story is the
same.What I want to know is, Do kids actually still know "This
Old Man"?
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 20:38:12 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Bruce (et al):Try hard.  As old as we are, we CAN do it.Ed----- Original Message -----
From: Bruce Olson <[unmask]>
Date: Tuesday, August 19, 2003 6:25 pm
Subject: Re: Shaggy Dogs> edward cray wrote:
> >
> > "It's a knickknack, Patty Whack. Give the frog a
> > loan. His old man's a Rolling Stone."
> >
> > (You're singing it, aren't you?!!)
> >
> > Ed Cray
>
> How am I ever going to remember the real words after that?
> Bruce Olson
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at Bruce Olson's website <A
> href="http://www.erols.com/olsonw"> Click
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Edie Gale Hays <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 22:46:21 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


>What I want to know is, Do kids actually still know "This
>Old Man"?The ones who attend summer camp in their elementary school years.  Kids
will sing ANYTHING.Edie

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: The Folk Process Is Not Dead
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 19 Aug 2003 20:54:48 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(23 lines)


Folks:In response to a shaggy dog story I mailed to the list, Bob Waltz commented:Just to show that there is folk processing out there still, the
person I heard this from had some detail about how the frog
was descended from Kermit of the Muppets as well as from Mick
Jagger. Details I can't recall. The rest of the story is the
same.What I want to know is, Do kids actually still know "This
Old Man"?
--To which I replied:Bob:Let me assure you that Emily Igler, 8, and her younger sister, Tessa, soon to be
4, both of Palo Alto, California, are very familiar with "This Old Man."  And
they have never been to summer camp either.Grandpa Ed

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 04:07:44 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(83 lines) , text/html(80 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Cecil Sharp Radio Programme
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 06:19:20 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(14 lines) , text/html(9 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Lewis Becker <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 11:08:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(60 lines)


That's great. Thanks.  Even some of us 60+ haven't heard it (or perhaps
more accurately and more threateningly - don't remember having heard
it).One question - why is the frog Irish?  It doesn't connect to anything
in the punchline?Lew>>> [unmask] 8/19/2003 8:53:59 PM >>>
Folks:I know, it's an old joke, but just in case one of the younger
subscribers hasn't heard this one (as forwarded by my daughter):An Irish Frog goes into a bank and approaches the teller. He can see
from her nameplate that her name is Patricia Whack. "Miss Whack, I'd
like to get a $30,000 loan to take a holiday." Patty looks at the frog
in disbelief and asks his name. The frog says his name is Kermit
Jagger,
his dad is Mick Jagger, and that it's okay, he knows the bank manager.Patty explains that he will need to secure the loan with some
collateral
The frog says, "Sure. I have this," and produces a tiny porcelain
elephant, about half an inch tall - bright pink and perfectly formed.
Very confused, Patty explains that she'll have to consult with the
bank
manager and disappears into a back office. She finds the manager and
says, "There's a frog called Kermit Jagger out there who claims to
know
you and wants to borrow $30,000, and he wants to use this as
collateral." She holds up the tiny pink elephant. "I mean, what in the
world is this?"(you're gonna love this)(its a real treat)(masterpiece)(wait for it)The bank manager looks back at her and says..."It's a knickknack, Patty Whack. Give the frog a
loan. His old man's a Rolling Stone."(You're singing it, aren't you?!!)Ed Cray

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Cecil Sharp Radio Programme
From: "Steiner, Margaret" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 10:23:49 -0500
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(21 lines) , text/html(31 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Lewis Becker <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 11:10:50 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(61 lines)


That's great. Thanks.  Even some of us 60+ haven't heard it (or perhaps
more accurately and more threateningly - don't remember having heard
it).One question - why is the frog Irish?  It doesn't connect to anything
in the punchline.Lew>>> [unmask] 8/19/2003 8:53:59 PM >>>
Folks:I know, it's an old joke, but just in case one of the younger
subscribers hasn't heard this one (as forwarded by my daughter):An Irish Frog goes into a bank and approaches the teller. He can see
from her nameplate that her name is Patricia Whack. "Miss Whack, I'd
like to get a $30,000 loan to take a holiday." Patty looks at the frog
in disbelief and asks his name. The frog says his name is Kermit
Jagger,
his dad is Mick Jagger, and that it's okay, he knows the bank manager.Patty explains that he will need to secure the loan with some
collateral
The frog says, "Sure. I have this," and produces a tiny porcelain
elephant, about half an inch tall - bright pink and perfectly formed.
Very confused, Patty explains that she'll have to consult with the
bank
manager and disappears into a back office. She finds the manager and
says, "There's a frog called Kermit Jagger out there who claims to
know
you and wants to borrow $30,000, and he wants to use this as
collateral." She holds up the tiny pink elephant. "I mean, what in the
world is this?"(you're gonna love this)(its a real treat)(masterpiece)(wait for it)The bank manager looks back at her and says..."It's a knickknack, Patty Whack. Give the frog a
loan. His old man's a Rolling Stone."(You're singing it, aren't you?!!)Ed Cray

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 08:39:31 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(74 lines)


Lew:You got me.  It's a red herring.Ed----- Original Message -----
From: Lewis Becker <[unmask]>
Date: Wednesday, August 20, 2003 8:08 am
Subject: Re: Shaggy Dogs> That's great. Thanks.  Even some of us 60+ haven't heard it (or perhaps
> more accurately and more threateningly - don't remember having heard
> it).
>
> One question - why is the frog Irish?  It doesn't connect to anything
> in the punchline?
>
> Lew
>
> >>> [unmask] 8/19/2003 8:53:59 PM >>>
> Folks:
>
> I know, it's an old joke, but just in case one of the younger
> subscribers hasn't heard this one (as forwarded by my daughter):
>
> An Irish Frog goes into a bank and approaches the teller. He can see
> from her nameplate that her name is Patricia Whack. "Miss Whack, I'd
> like to get a $30,000 loan to take a holiday." Patty looks at the frog
> in disbelief and asks his name. The frog says his name is Kermit
> Jagger,
> his dad is Mick Jagger, and that it's okay, he knows the bank manager.
>
> Patty explains that he will need to secure the loan with some
> collateral
> The frog says, "Sure. I have this," and produces a tiny porcelain
> elephant, about half an inch tall - bright pink and perfectly formed.
> Very confused, Patty explains that she'll have to consult with the
> bank
> manager and disappears into a back office. She finds the manager and
> says, "There's a frog called Kermit Jagger out there who claims to
> know
> you and wants to borrow $30,000, and he wants to use this as
> collateral." She holds up the tiny pink elephant. "I mean, what in the
> world is this?"
>
>
> (you're gonna love this)
>
>
>
> (its a real treat)
>
>
>
> (masterpiece)
>
>
> (wait for it)
>
>
>
>
> The bank manager looks back at her and says...
>
> "It's a knickknack, Patty Whack. Give the frog a
> loan. His old man's a Rolling Stone."
>
> (You're singing it, aren't you?!!)
>
> Ed Cray
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Elizabeth Hummel <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 11:58:30 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(77 lines)


But Lew-The frog HAS to be Irish for the punch line to work...Bad pun...It's "Paddywack"Liz In New hampshire-----Original Message-----
From: Lewis Becker [mailto:[unmask]]
Sent: Wednesday, August 20, 2003 11:08 AM
To: [unmask]
Subject: Re: Shaggy DogsThat's great. Thanks.  Even some of us 60+ haven't heard it (or perhaps
more accurately and more threateningly - don't remember having heard
it).One question - why is the frog Irish?  It doesn't connect to anything
in the punchline?Lew>>> [unmask] 8/19/2003 8:53:59 PM >>>
Folks:I know, it's an old joke, but just in case one of the younger
subscribers hasn't heard this one (as forwarded by my daughter):An Irish Frog goes into a bank and approaches the teller. He can see
from her nameplate that her name is Patricia Whack. "Miss Whack, I'd
like to get a $30,000 loan to take a holiday." Patty looks at the frog
in disbelief and asks his name. The frog says his name is Kermit
Jagger,
his dad is Mick Jagger, and that it's okay, he knows the bank manager.Patty explains that he will need to secure the loan with some
collateral
The frog says, "Sure. I have this," and produces a tiny porcelain
elephant, about half an inch tall - bright pink and perfectly formed.
Very confused, Patty explains that she'll have to consult with the
bank
manager and disappears into a back office. She finds the manager and
says, "There's a frog called Kermit Jagger out there who claims to
know
you and wants to borrow $30,000, and he wants to use this as
collateral." She holds up the tiny pink elephant. "I mean, what in the
world is this?"(you're gonna love this)(its a real treat)(masterpiece)(wait for it)The bank manager looks back at her and says..."It's a knickknack, Patty Whack. Give the frog a
loan. His old man's a Rolling Stone."(You're singing it, aren't you?!!)Ed Cray

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Request for Help
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 08:59:38 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(40 lines)


Good People:A quick search of my fiddle tune books -- Fraser, Francis O'Neill,
Ryan's Mammoth Collection, etc. -- did not turn up anything.Can anyone help Adam?Ed----------------------------------------------------------------------From Adam Miller <[unmask]>
Sent  Wednesday, August 20, 2003 4:02 am
To  [unmask]
Cc
Bcc
Subject  Eagle's WhistleDear Ed,I'm researching the song "Eagle's Whistle".  It's supposed to be one of the
oldest of tunes.  Originally from Ireland, it was the marching tune of the
Clan Donovan.  It is the ancestor of 'Bonaparte's Retreat".Who would you suggest I contact regarding it's alleged ancient origins?I'm asking because I'm working on a new album of Sam Hinton's solo harmonica
performances.  Sam has long told the story that King Cormac McArt liked to
go to sleep listening to this song.  But I haven't been able to find
anything that supports Sam's assertion.  I just visited Sam, but he couldn't
offer any sources.Thanks,Adam Miller
P.O. Box 620754
Woodside, CA  94062
(650)  804-2049
[unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 12:27:51 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(93 lines) , text/html(111 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 11:49:09 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(3 lines)


The notes to Frank Ferrel's 'Yankee Dreams' state "[l]earned from
Shetland fiddler, Ali Bain, 'The Eagle's Whistle' is an old Irish pipe
march."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shaggy Dogs
From: Cal & Lani Herrmann <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 10:18:00 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


On Wed, Aug 20, 2003 at 08:39:31AM -0700, edward cray wrote:
> Lew:
>
> You got me.  It's a red herring.
>
> Ed
>
> ----- Original Message -----
> From: Lewis Becker <[unmask]>
> Date: Wednesday, August 20, 2003 8:08 am
> Subject: Re: Shaggy Dogs
>
> > That's great. Thanks.  Even some of us 60+ haven't heard it (or perhaps
> > more accurately and more threateningly - don't remember having heard
> > it).
> >
> > One question - why is the frog Irish?  It doesn't connect to anything
> > in the punchline?
> >
> > LewWell... frogs are spozed to be GREEN, aren't they?  As we're all mandated
to wear something that color on St Pat's??  (okay, back to your cages!)
-- Aloha, Lani<||> Lani Herrmann * [unmask] (or: [unmask])
<||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 14:16:05 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(86 lines)


dick greenhaus wrote:
>
> >From Folk Music Index
>
>      The Eagle's Whistle
>
>           At - Mairsea(i)l Ui Dhonncha ; Eagle's Tune
>
>           Rm - Bonaparte's Retreat
>
>        1. Ferrel, Frank. Yankee Dreams, Flying Fish FF 70572, CD
>           (1991), cut# 4a
>        2. McKenna, Joe and Antoinette. Joe and Antoinette
>           McKenna, Shanachie 29011, LP (1978), cut# 3
>        3. Mitchell, Pat. Uilleann Pipes, Topic 12TS 294, LP
>           (1976), cut# 12
>        4. O'Riada, Sean; and Ceoltoiri Chualann. O'Riada,
>           Gael-Linn CEF 032, LP (197?), cut# 3 (Fead An Iolair)
>
>      Eagle's Whistle (Lullaby)
>
>        1.
>           Hinton, Sam. Real McCoy, Decca DL 857, LP (196?), cut#
>           13
>        2. Hinton, Sam. Whoever Shall Have Some Good Peanuts,
>           Scholastic SC 7530, LP (1964), cut#B.08
>
> edward cray wrote:
>
>      Good People:
>
>      A quick search of my fiddle tune books -- Fraser, Francis
>      O'Neill,
>      Ryan's Mammoth Collection, etc. -- did not turn up anything.
>
>      Can anyone help Adam?
>
>      Ed
>
>      ----------------------------------------------------------------------
>
>      >From Adam Miller <[unmask]>
>      Sent  Wednesday, August 20, 2003 4:02 am
>      To  [unmask]
>      Cc
>      Bcc
>      Subject  Eagle's Whistle
>
>      Dear Ed,
>
>      I'm researching the song "Eagle's Whistle".  It's supposed
>      to be one of the
>      oldest of tunes.  Originally from Ireland, it was the
>      marching tune of the
>      Clan Donovan.  It is the ancestor of 'Bonaparte's Retreat".
>
>      Who would you suggest I contact regarding it's alleged
>      ancient origins?
>
>      I'm asking because I'm working on a new album of Sam
>      Hinton's solo harmonica
>      performances.  Sam has long told the story that King Cormac
>      McArt liked to
>      go to sleep listening to this song.  But I haven't been able
>      to find
>      anything that supports Sam's assertion.  I just visited Sam,
>      but he couldn't
>      offer any sources.
>
>      Thanks,
>
>      Adam Miller
>      P.O. Box 620754
>      Woodside, CA  94062
>      (650)  804-2049
>      [unmask]
>
>What is probably the oldest published version was collected in 1828, and
published in 1829 ('Sources of Irish Traditional Music', #5851) Possibly
older, from a MS of a 'P. Carew' are variants #306 and 306 in the
complete Petrie Collection.and broadside ballads at Bruce Olson's website <A
href="http://www.erols.com/olsonw"> Click </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: FWIW - Away Here in Texas
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 14:32:49 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(60 lines)


eBay can be a source of song texts.  I discovered that earlier with a
W. T. Blankenship broadside.  Recently, Delores included a manuscript
ballet, "Away Here in Texas," on her eBay list.  I didn't bid on it,
but I was delighted that the seller posted a transcription of the
words.The first two verses appeared in The Sacred Harp in 1859.  This song
was later dropped from the Denson line of Sacred Harp editions but
retained in the Cooper line.  Perhaps the first two verses weren't
religious enough for the Denson editors.Anyhow, the seller's transcription supplies 4 "new" verses, including
some religious ones.I don't know whether or not a text beyond the first two verses is
available elsewhere.******January the 1 1862.1. Away here in Texis as the bright sunny south
The coald stormy winter defy
The darke lowring clouds that incircle the north
Seldom darke our beautiful skies2. Away heare in Texis the sun shines so bright
The stores in their beauty appeare
The full mon in splendor illumins the night
And the seasons roll round with yeare3. Away heare in Texis the beautiful flowers
Peculiar brilliant and gay
The birds with thiere music beguile the dull hours
They enchantingly sing all the day4. Away heare in Texis a stranger I roam
Unknown unto all but a few
But I travil in hope of a fair beter world
When I will take my last sad adieu5. Away hear in Texis my journey shal end
My body be laide in the ground
But I hope to arise and to glory asend
When Gabrel his strumpet shal sound6. The a ransom from Texas I'll rise from my tombe
To mete my deare lorde in the air
For the word of his promise will bare me safe home
And forever will dwell with him thare.Jan the 1 1862
John T McCall.
******This was copied mechanically, i.e., electronically, from the seller's
eBay posting.  Thus, if "When Gabrel his strumpet shal sound" is an
error, it isn't mine.
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 14:40:40 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(54 lines) , text/html(51 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 15:20:46 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(24 lines)


Bruce Olson wrote:
>
> What is probably the oldest published version was collected in 1828, and
> published in 1829 ('Sources of Irish Traditional Music', #5851) Possibly
> older, from a MS of a 'P. Carew' are variants #305 [corrected] and 306 >in the  complete Petrie Collection.Wow! I erased part of my last message and sent it at the same time. I
couldn't do that again if I tried.At any rate, the full title to SITM #5851 is "The Eagle's Whistle, or
O'Donoghue's Call" The tune was collected from famed piper James Gandsey
[about whom see Breandan Breathnach's article on Kerry pipers in 'Irish
Folk Music Studies'].I'm assuming here that I have correctly identified the tune. In the file
COMCODE3.TXT on my website are 3 different tunes called "The Eagle's
Whistle"Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at Bruce Olson's website <A
href="http://www.erols.com/olsonw"> Click </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: Nigel Gatherer <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 20 Aug 2003 20:10:35 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(47 lines)


In article <[unmask]>, edward cray
<[unmask]> wrote:> I'm researching the song "Eagle's Whistle".  It's supposed to be one
> of the oldest of tunes...Song? Can't help. Tune? Maybe...Also called "O'Donovan's March", this one is from Joyce's Old Irish
Folk Music and Songs where he says "I copied the following...from a MS
book lent me by Surgeon-Major-General King of Dublin (about 1885), who
copied them 40 years previously from an old MS. book in Cork. I gave a
setting of this in my 'Ancient Irish Music' and there are two others in
the Stanford-Petrie Collection. These three are in 3/4 time whereas the
setting I now give is in 2/4, which is no doubt the proper original
form, inasmuch as this was the marching tune of O'Donovans (See my
'Ancient Irish Music' p53). The Cork MS has this remark: 'The legend
tells that with this tune the eagle whistles his young to rest.'"X:578
T:Eagle's Whistle, The
B:Joyce, "Old Irish Folk Music & Songs"
Z:Nigel Gatherer
L:1/16
M:2/4
K:G
G | B2 B2 dBAG  | B2 B2 dBAG  | B2 A2 A2 BG | B2 A2 A2 BG |
    B2 B2 dBAG  | B2 B2 dBAG  | E2 G2 G3  A | E2 G2 G3   :|
d | edef  e2 dB | dBdg  d2 BA | d2 g2 dBAG  | B2 A2 A2 BG |
    edef  e2 dB | dBdg  d2 BA | B2 ge dBAG  | E2 GG G3   |]X:579
T:Eagle's Whistle, The
S:Forgotten or lost
Z:Nigel Gatherer
L:1/8
M:3/4
K:G
DGA | B2    dBAG | BA/B/ dBAG    | A2 A>BAG   | A3
DGA | B2    dBAG | BA/B/ dBAB/A/ | G2 GBAB/A/ | G2 G  :|
ABd | ef/e/ degf | ef/e/ dBAG    | A2 A>BAG   | A3
ABd | ef/e/ degf | ef/e/ dBAB/A/ | G2 GBAB/A/ | G2 G :|]--
Nigel Gatherer, Crieff, Scotland
[unmask]
http://www.argonet.co.uk/users/gatherer/

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Irish Songs from Old New England
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 21 Aug 2003 18:23:13 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


I too would like to add my unreserved pleasure in this CD. I had the pleasure of being at The Champlain Valley Folk Festival this August where an afternoon concert was dedicated to the presentation of this collection and the newly released CD. A wonderful concert, a fascinating collection and a great CD.
Kathleen---- Original message ----
>Date: Tue, 12 Aug 2003 11:14:50 -0700
>From: edward cray <[unmask]>
>Subject: Irish Songs from Old New England>The r esult is a ceili of delights.
d

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: re, re: Irish Songs from Old New England
From: Pat Holub <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 22 Aug 2003 15:09:19 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(13 lines)


Ed, Kathleen and all:     Now, I can't resist adding my compliments about this wonderful album.
Some people who are--unlike myself--knowledgeable about folklore may be
interested to know that all the songs are from the Flanders collection.
Each of the vocal performances is really outstanding.     I have the album because a good friend of mine saw it and concluded,
"that has Pat's name on it," and bought it for me.  There are times when
there's nothing as valuable as a good friend.Regards,
Pat

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Request for Help
From: George Madaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 10:05:14 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(73 lines)


The Eagle's Whistle I know of is a march played by Irish pipers. It is
on an old recordl that I would have to try an locateGeorgeOn Wednesday, August 20, 2003, at 02:40  PM, Fred McCormick wrote:> If we are talking about the same Eagle's Whistle, see also Claddagh.
> CC 19. Féilim Tonn Rí's Castle (Or the King of Ireland's Son), where
> it is played by Seamus Ennis.
>
> Cheers,
>
> Fred McCormick
>
>
> In a message dated 20/08/2003 19:16:59 GMT Standard Time,
> [unmask] writes:
>
>
> dick greenhaus wrote:
> >
> > >From Folk Music Index
> >
> >      The Eagle's Whistle
> >
> >           At - Mairsea(i)l Ui Dhonncha ; Eagle's Tune
> >
> >           Rm - Bonaparte's Retreat
> >
> >        1. Ferrel, Frank. Yankee Dreams, Flying Fish FF 70572, CD
> >           (1991), cut# 4a
> >        2. McKenna, Joe and Antoinette. Joe and Antoinette
> >           McKenna, Shanachie 29011, LP (1978), cut# 3
> >        3. Mitchell, Pat. Uilleann Pipes, Topic 12TS 294, LP
> >           (1976), cut# 12
> >        4. O'Riada, Sean; and Ceoltoiri Chualann. O'Riada,
> >           Gael-Linn CEF 032, LP (197?), cut# 3 (Fead An Iolair)
> >
> >      Eagle's Whistle (Lullaby)
> >
> >        1.
> >           Hinton, Sam. Real McCoy, Decca DL 857, LP (196?), cut#
> >           13
> >        2. Hinton, Sam. Whoever Shall Have Some Good Peanuts,
> >           Scholastic SC 7530, LP (1964), cut#B.08
> >
> > edward cray wrote:
> >
> >      Good People:
> >
> >      A quick search of my fiddle tune books -- Fraser, Francis
> >      O'Neill,
> >      Ryan's Mammoth Collection, etc. -- did not turn up anything.
> >
> >      Can anyone help Adam?
> >
> >      Ed
> >
>
>
George F. Madaus
Boisi Professor of Education and Public Policy
Senior Research Fellow
National Board on Educational Testing and Public Policy
Center for the Study of Testing Evaluation and Educational Policy
Carolyn A. and Peter S. Lynch School of Education
Boston College
Chestnut Hill MA 02467
[unmask]
617. 552.4521
617 552 8419 FAX

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Cecil Sharp Radio Programme
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 20:27:37 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(40 lines)


The programme is on Tuesday 26th Aug. at 13.30. You can listen live on the
internet, or at any time during the following week, using their 'Listen Again'
facility. Start at:
http://www.bbc.co.uk/radio4/arts/Steve Roud[unmask] wrote:> Fred, I'm confused.  Thursday is the 28th of August.  So, will the program
air on Tuesday, the 26th, or on Thursday the 28th?
>
>     Marge
>
> -----Original Message-----
> From: Fred McCormick [mailto:[unmask]]
> Sent: Wednesday, August 20, 2003 5:19 AM
> To: [unmask]
> Subject: Cecil Sharp Radio Programme
>
>
> Listers able to receive BBC Radio 4 may like to listen in on Thursday 26
August at 13-30 hrs, British Summer Time. Malcolm Taylor, librarian of the
Vaughan Williams Memorial Library, is presenting a 1/2 hour programme on Cecil
Sharp called The Seeds of Love. There is a fair amount of interest in England
just now in reassessing Sharp, so the programme blurb may be significant;-
>
> "......did he appropriate the culture of the rural working class or did he
restore to the English their vanishing musical heritage."
>
> Cheers,
>
> Fred McCormick.
>--
Message sent with Supanet E-mail

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Cecil Sharp Radio Programme
From: "Steiner, Margaret" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 15:05:56 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(52 lines)


Thanks for the clarification.  Incidentally, I'm not sure if I E-mailed you a month or so ago re the arrival of the update to the folk Song and Broadside indices.  Haven't had time to deai with them yet, but hope to do so this week.  Thanks for your erstwhile dedication to this work.Cheers!        Marge
-----Original Message-----
From: [unmask] [mailto:[unmask]]
Sent: Saturday, August 23, 2003 2:28 PM
To: [unmask]
Subject: Re: Cecil Sharp Radio ProgrammeThe programme is on Tuesday 26th Aug. at 13.30. You can listen live on the
internet, or at any time during the following week, using their 'Listen Again'
facility. Start at:
http://www.bbc.co.uk/radio4/arts/Steve Roud[unmask] wrote:> Fred, I'm confused.  Thursday is the 28th of August.  So, will the program
air on Tuesday, the 26th, or on Thursday the 28th?
>
>     Marge
>
> -----Original Message-----
> From: Fred McCormick [mailto:[unmask]]
> Sent: Wednesday, August 20, 2003 5:19 AM
> To: [unmask]
> Subject: Cecil Sharp Radio Programme
>
>
> Listers able to receive BBC Radio 4 may like to listen in on Thursday 26
August at 13-30 hrs, British Summer Time. Malcolm Taylor, librarian of the
Vaughan Williams Memorial Library, is presenting a 1/2 hour programme on Cecil
Sharp called The Seeds of Love. There is a fair amount of interest in England
just now in reassessing Sharp, so the programme blurb may be significant;-
>
> "......did he appropriate the culture of the rural working class or did he
restore to the English their vanishing musical heritage."
>
> Cheers,
>
> Fred McCormick.
>--
Message sent with Supanet E-mail

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: real audio question
From: Pat Holub <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 17:54:38 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


Hello,
     Does anyone happen to have the exact http of the Austin TX radio
station which would connect me to the live broadcast of that station?  I
used to have it, but can't find it now.  I've lately been fooling around
with a local message board and, while listening to their audio, I lost a
few things from my real player files.  I recovered some because I had the
right http information, but I can't find the one for KUT.     Thanks in advance.Regards,
Pat Holub

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: real audio question
From: "Steiner, Margaret" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 17:20:14 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(23 lines)


Why not just do a Google search, type in KUT, and then follow the links?  Then you can add it to your favorites.        Marge-----Original Message-----
From: Pat Holub [mailto:[unmask]]
Sent: Saturday, August 23, 2003 4:55 PM
To: [unmask]
Subject: real audio questionHello,
     Does anyone happen to have the exact http of the Austin TX radio
station which would connect me to the live broadcast of that station?  I
used to have it, but can't find it now.  I've lately been fooling around
with a local message board and, while listening to their audio, I lost a
few things from my real player files.  I recovered some because I had the
right http information, but I can't find the one for KUT.     Thanks in advance.Regards,
Pat Holub

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: real audio question
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 19:03:32 EDT
Content-Type:text/plain
Parts/Attachments:

text/plain(6 lines)


Dear Pat,Try http://kut.org/index.htmlSam Hinton
La Jolla, CA

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: real audio question
From: Pat Holub <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 23 Aug 2003 23:07:41 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


At 07:03 PM 8/23/03 -0400, you wrote:
>Dear Pat,
>
>Try http://kut.org/index.html
>
>Sam Hinton
>La Jolla, CA
>Sam, thanks for the suggestion, but it doesn't seem to work for me.Pat

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Three Nights Drunk and the Market Tup
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 04:56:24 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(21 lines) , text/html(14 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Cecil Sharp Radio Programme Correction
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 05:02:29 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(24 lines) , text/html(16 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: real audio question
From: Jeri Corlew <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 10:01:06 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(20 lines)


On Sat, 23 Aug 2003 23:07:41 -0400, Pat Holub <[unmask]>
wrote:>At 07:03 PM 8/23/03 -0400, you wrote:
>>Dear Pat,
>>
>>Try http://kut.org/index.html
>>
>>Sam Hinton
>>La Jolla, CA
>>Sam, thanks for the suggestion, but it doesn't seem to work for me.
>
Pat, Sam's link is to the website for CKUT.
The link directly to the Real Audio broadcast is:
http://www.publicbroadcasting.net/kut/ppr/kut.ram--
Jeri Corlew

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Ebay List - 08/24/03
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 13:08:53 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(67 lines)


Hi!        While recovering from a fall down the stairs, I've kept
searching Ebay. Here are the latest finds.        SONGSTERS        3623233747 - Blaine & Logan Campaign Songster, 1884, $24.99
w/reserve (ends Aug-26-03 19:25:23 PDT)        3238657401 - Everybody Works But Father Songster, Dockstader,
1905, $12 (ends Aug-27-03 18:49:15 PDT)        2188879521 - Buffalo Bill's Wild West Songster, $7.85 w/reserve
(ends Aug-29-03 14:07:50 PDT)        SONGBOOKS, ETC.        3545487480 - One Hundred English Folksongs by Sharp, 1944 Dover
edition, $12 (ends Aug-25-03 17:37:55 PDT)        2552191443 - THE PEOPLE'S SONG BOOK by Hill, 1963 printing, $20
(ends Aug-25-03 18:00:00 PDT)        3545506488 - HARD HITTING SONGS FOR HARD-HIT PEOPLE by Lomax,
1967, $9.95 (ends Aug-25-03 19:04:33 PDT)        3545529232 - Folk Songs of Canada by Fowke & Johnson, 1975,
$9.99 (ends Aug-25-03 21:23:20 PDT)        3545972907 - Folk Songs of the Caribbean by Morse, 1958, $6
(ends Aug-27-03 20:43:54 PDT)        3546004560 - ORD'S BOTHY SONGS AND BALLADS, 3.50 GBP (ends
Aug-28-03 06:59:23 PDT)        3546073697 - The Faber Book of Ballads by Hodgart, 1971, $10.50
(ends Aug-28-03 12:31:51 PDT)        3545826332 & 3545829551 - issues of Spin folk song magazine,
early 1960's, 0.99 GBP (ends Aug-30-03 08:32:15 PDT)        2553271979 - The Book of British Ballads by Hall, 2 volumes,
1842 & 1844, 15 GBP (ends Aug-30-03 09:13:21 PDT)        3546437800 - THE MAINE WOODS SONGSTER by Barry, 1939, $50 (ends
Aug-30-03 11:46:37 PDT)        2553325062 - SCHIRMER'S AMERICAN FOLK-SONG SERIES: SET 14, SONGS
OF THE HILL-FOLK: 12 BALLADS FROM KENTUCKY, VIRGINIA, AND NORTH CAROLINA
by Niles, 1934?, $6.99 (ends Aug-30-03 14:15:44 PDT)        2553337117 - 2 Sizemore & Little Jimmy Songbooks, 1936 & 1947,
$5 (ends Aug-30-03 15:49:07 PDT)        3546045198 - ENGLISH FOLK SONGS FROM THE SOUTHERN APPALACHIANS
by Campbell & Sharp, 1917, 62 GBP w/reserve (ends Aug-31-03 10:49:42
PDT)                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Cecil Sharp Radio Programme Correction
From: "Steiner, Margaret" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 13:44:56 -0500
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(28 lines) , text/html(36 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay List - 08/24/03
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 17:15:18 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(78 lines)


I'm interested in Ord's Bothy Ballads; is someone else bidding on this?
Norm Cohen----- Original Message -----
From: "Dolores Nichols" <[unmask]>
To: <[unmask]>
Sent: Sunday, August 24, 2003 10:08 AM
Subject: Ebay List - 08/24/03> Hi!
>
>         While recovering from a fall down the stairs, I've kept
> searching Ebay. Here are the latest finds.
>
>         SONGSTERS
>
>         3623233747 - Blaine & Logan Campaign Songster, 1884, $24.99
> w/reserve (ends Aug-26-03 19:25:23 PDT)
>
>         3238657401 - Everybody Works But Father Songster, Dockstader,
> 1905, $12 (ends Aug-27-03 18:49:15 PDT)
>
>         2188879521 - Buffalo Bill's Wild West Songster, $7.85 w/reserve
> (ends Aug-29-03 14:07:50 PDT)
>
>         SONGBOOKS, ETC.
>
>         3545487480 - One Hundred English Folksongs by Sharp, 1944 Dover
> edition, $12 (ends Aug-25-03 17:37:55 PDT)
>
>         2552191443 - THE PEOPLE'S SONG BOOK by Hill, 1963 printing, $20
> (ends Aug-25-03 18:00:00 PDT)
>
>         3545506488 - HARD HITTING SONGS FOR HARD-HIT PEOPLE by Lomax,
> 1967, $9.95 (ends Aug-25-03 19:04:33 PDT)
>
>         3545529232 - Folk Songs of Canada by Fowke & Johnson, 1975,
> $9.99 (ends Aug-25-03 21:23:20 PDT)
>
>         3545972907 - Folk Songs of the Caribbean by Morse, 1958, $6
> (ends Aug-27-03 20:43:54 PDT)
>
>         3546004560 - ORD'S BOTHY SONGS AND BALLADS, 3.50 GBP (ends
> Aug-28-03 06:59:23 PDT)
>
>         3546073697 - The Faber Book of Ballads by Hodgart, 1971, $10.50
> (ends Aug-28-03 12:31:51 PDT)
>
>         3545826332 & 3545829551 - issues of Spin folk song magazine,
> early 1960's, 0.99 GBP (ends Aug-30-03 08:32:15 PDT)
>
>         2553271979 - The Book of British Ballads by Hall, 2 volumes,
> 1842 & 1844, 15 GBP (ends Aug-30-03 09:13:21 PDT)
>
>         3546437800 - THE MAINE WOODS SONGSTER by Barry, 1939, $50 (ends
> Aug-30-03 11:46:37 PDT)
>
>         2553325062 - SCHIRMER'S AMERICAN FOLK-SONG SERIES: SET 14, SONGS
> OF THE HILL-FOLK: 12 BALLADS FROM KENTUCKY, VIRGINIA, AND NORTH CAROLINA
> by Niles, 1934?, $6.99 (ends Aug-30-03 14:15:44 PDT)
>
>         2553337117 - 2 Sizemore & Little Jimmy Songbooks, 1936 & 1947,
> $5 (ends Aug-30-03 15:49:07 PDT)
>
>         3546045198 - ENGLISH FOLK SONGS FROM THE SOUTHERN APPALACHIANS
> by Campbell & Sharp, 1917, 62 GBP w/reserve (ends Aug-31-03 10:49:42
> PDT)
>
>                                 Happy Bidding!
>                                 Dolores
>
> --
> Dolores Nichols                 |
> D&D Data                        | Voice :       (703) 938-4564
> Disclaimer: from here - None    | Email:     <[unmask]>
>         --- .sig? ----- .what?  Who me?
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay List - 08/24/03
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 24 Aug 2003 21:51:17 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(15 lines)


Norm Cohen wrote:
>
> I'm interested in Ord's Bothy Ballads; is someone else bidding on this?
> Norm Cohen
>Original and reprint editions available, over a wide range of prices, at
www.bookfinder.com.  I have the reprint, c 1998, which doesn't give its
date.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at Bruce Olson's website <A
href="http://www.erols.com/olsonw"> Click </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: FWIW: Rosin the Beau (very long)
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 26 Aug 2003 17:06:08 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(207 lines)


There has been some discussion on Fasola of SAWYER'S EXIT and Rosin
the Beau (Bow).  FWIW, here is something on the latter song fromMemoirs of Judge Richard H. Clark
edited by
Lollie Belle Wylie
Atlanta, GA.
Franklin Printing and Publishing Company
Geo. W. Harrison, Manager
1898An entire chapter of this book is devoted to, and entitled, "Rosin
the Beau."  Quoted therefrom: From the beginning and ever afterward during his life, it [Rosin the
Beau] was attributed to a man well known in nearly all parts of
Georgia, and even in several other Southern States, named Lawrence T.
Wilson.  It was claimed by him, and from the evidence then all his
contemporaries conceded it to him.  There was no one to dispute the
title with him.  He went by the name of "Beau Wilson," and the
authorship of this song was supposed to be the cause of this prefix.
He was recognized as a professional gambler, and likewise there was
no one to dispute this, for wherever there was a gathering and a
collection of this class of sports in Georgia, there was Beau Wilson,
and he was a conspicuous figure among them.  Those who do not know
cannot realize the situation then.  The gamblers were a distinct and
well-defined class.  In summer they traveled from one watering-place
to another, and in the winter from one city to another - from
race-course to race-course, from legislature to legislature, and even
from court to court.  They appeared at each place in full force, and
did not disguise their purpose.  This was the custom even as late as
"the war," which scattered them, and they have never rallied in force
since.  During the war "Beau Wilson" disappeared, and has never since
been heard of, except that some time within the four years he died at
Shreveport, La.  He was born at old Petersburg, Ga., in 1801.  He
received a good education for the times, and was a man of good
presence and goo manners.  He was popular with his sort, and had many
friends outside of them.
...
Wilson was inspired to write the song from finding one morning an old
fiddler whom he had often met and befriended dead and laid out on the
counter of one of the saloons he frequented.  He read and sang the
verses to his friends, and they persuaded him to publish them.  Those
verses, as they appear in the music book [The Good Old Songs We Used
to Sing, compiled by J. C. H. (Joel Chandler Harris?), Oliver Ditson
& Co., 1867], are as follows:I live for the good of my nation,
  And my suns are all growing low,
But I hope that the next generation
  Will resemble old Rosin the Beau.I've traveled this country all over,
  And now to the next I will go,
For I know that good quarters await me,
  To welcome old Rosin the Beau.In the gay round of pleasure I traveled
  Nor will I behind leave a foe,
And when my companions are jovial
  They will drink to old Rosin the Beau.But my life is now drawn to a closing,
  And all will at last be so,
So we'll take a full bumper at parting
  To the name of old Rosin the Beau.I'll have to be buried, I reckon,
  And the ladies will all want to know,
And they'll lift up the lid of my coffin
  Saying, "Here lies old Rosin the Beau."Oh! when to my grave I am going,
  The children will all want to know,
They'll run to the doors and the windows
  Saying, "Here goes old Rosin the Beau."Then pick me out six trusty fellows
  And let them all stand in a row,
And dig a big hole for a circle,
  And in it toss Rosin the Beau.Then shape out two little dornicks,
  Place one at my head and my toe,
And do not forget to scratch on it
  The name of old Rosin the Beau.Then pick me out six trusty fellows,
  Oh! let them all stand in a row,
And take down the big-bellied bottle
  And drink to old Rosin the Beau.While it is true that Wilson is the author of this song, it is also
true that there was an older song, which Wilson must have seen, and
from which he got the idea of composing it when he saw his fiddler
friend dead.  This is evident from the similarity, yet slight subtle
difference in name, and that his last two verses are substantially
the same as the older version, and that the tune to his is the same
as the tune to the other.  That other, and the first, is "Rossum the
Beau," and was written by the late Colonel William H. Sparks, the
author of "The Memories of Fifty Years," and other literature.  I
will let Colonel Sparks relate the history of his song in his own
words:Letter from Colonel W. H. Sparks to W. H. Moore, dated Atlanta, Ga,
August 21, 1874:"My Dear Sir: - I am obliged to you for the little paragraph from the
Columbus paper, ascribing to me the authorship of this song, once so
popular throughout the country"It is very true I wrote the lines I send you, and they were the
first that were ever sung to the air which became famous."I will give you a brief history of the writing, and of the man who
inspired them.  When I first went to the West in 1825, I was some
time in selecting a domicile.  Why, it is not necessary for me to
state, as the reason and causes for the delay will form a theme for a
chapter in the second volume of the 'Memories of Fifty Years.'"Finally I located in Mississippi and commenced the practice of law.
It was in the midst of the noblest people I have ever known.  Among
these were two equally remarkable, but very unlike.  One was a
schoolmaster who was quite old, and who had been residing in the
neighborhood over forty years.  His name was James Rossum.  He was
peculiar in his habits.  On Monday morning, neatly dressed and
cleanly shaven, he went to his duties in the old schoolhouse where
two-thirds of his life had been spent, and assiduously devoted
himself to the duties of his vocation until Friday evening.  On the
morning of Saturday he arrayed himself in his best and devoted the
day to visiting the ladies of the neighborhood.  He was a welcome
guest at every house.  This habit had continued so long that he had
acquired the sobriquet of "Rossum the Beau."  The other's name was
Cox, who was a rollicking good fellow, and the best vocalist I ever
knew.  He was in song what Prentiss was in oratory, and they were
boon companions.  Both died young.  Cox was frequently in my office,
and upon one occasion while he was there, Rossum walked by the door,
and his age was apparent in his walk.  Cox looked at him, and, after
a pause, turned to me and remarked in quite a feeling tone, which he
could assume at pleasure, and its eloquence was irresistible, 'Poor
old Rossum!  Some of these sunny mornings he will be found dead, when
he shall have a noble funeral, and all the ladies will honor it with
being present, I know.'"Soon after he left the office, and, being in the humor, I seized the
ideas and wrote the following doggerel lines.  Soon after Cox
returned and I handed them to him.  He got up, walked and hummed
different airs, until he fell upon the old Methodist hymn tune in
which they have ever since been sung."I have always considered Cox more entitled to the authorship than myself."Hundreds of lines have been written to the air by as many persons,
and almost as many have claimed the authorship of the lines, but this
is of no moment.  I claim no merit for my lines, but everything for
Cox's singing of them.  I have seen him draw tears from the eyes of
old and young with the feeling he threw into the song."Now, soon on some soft, sunny morning,
  The first thing my neighbors shall know
Their ears shall be met with the warning,
  Come, bury old Rossum the Beau.My friends then so neatly shall dress me,
  In linen as white as the snow,
And in my new coffin shall press me,
  And whisper, poor Rossum the Beau.And when I'm to be buried, I reckon
  The ladies will all like to go,
Let them form at the foot of my coffin,
  And follow old Rossum the Beau.Then take you a dozen good fellows,
  And let them all staggering go,
And dig a deep hole in the meadow,
  And toss in of Rossum the Beau.Then shape out a couple of dornicks,
  Place one at the head and the toe,
And do not forget to scratch on it
  Here lies old Rossum the Beau.Then take you these dozen good fellows,
  And stand them all round in a row,
And drink out of a big-bellied bottle,
  Farewell to old Rossum the Beau.It necessarily follows from the evidence that Colonel Sparks's
"Rossum the Beau" must have been written at least as far back as
1830.  Wilson's must have been written between that time and 1840.  I
cannot exactly remember when I first heard Wilson's version, but I
know it was before April, 1834, for then I first saw the venerable
beau at Albany, Ga., present at a great horse-race, and who was
pointed out to me as the author of the song, then so generously sung.*******There follows more commentary, including the facts that Sparks was
born in Putnam County, GA, in 1800 and Wilson in Elbert County, GA,
in 1801.  Judge Clark suspected that if the tune was indeed "an old
Methodist hymn tune" that the Methodists must have excommunicated it
after it became associated with such rowdy, secular words.--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: FWIW: Rosin the Beau (very long)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 26 Aug 2003 19:47:29 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(72 lines)


John Garst wrote:
>
> There has been some discussion on Fasola of SAWYER'S EXIT and Rosin
> the Beau (Bow).  FWIW, here is something on the latter song from
>................>    Judge Clark suspected that if the tune was indeed "an old
> Methodist hymn tune" that the Methodists must have excommunicated it
> after it became associated with such rowdy, secular words.
>
> --
> john garst    [unmask]What old Methodist hymn tune?Note that an early sheet music issue of "Rosin then Beau" (not the two
1838 ones) in the Lester Levy Sheet Music Collection (on their website)
calls the song 'A Southern Ballad'.On the tune: There's basically nothing new below here except figuring
out what tunes some of Bayard's sometimes awkward references
actually refer to.S. P. Bayard, 'Dance to the Fiddle, March to the Fife', #620,
traces the tune to a "Gigg" following "The Lowlands
of Holand" in James Oswald's 2nd volume of 'A Collection of
Curious Scots Tunes', n.d. [1742]. I have not found a copy of
that work, but it's repeated (again perceeded by "The Lowlands of
Holand") in his 'Caledonian Pocket Companion', II, c 1745. Bayard
suggested that the tune was composed by Oswald himself (as for
other 'Gigg' and 'Gigga' Oswald scattered around in these works), and
I consider that quite likely also. While I had copied "The
Lowland of Holand" from CPC, I neglected to copy the 'Gigg', and
I was remiss in failing to note down my source for the ABC below,
but am reasonably certain that it was supplied by Jack Campin,
after my request for it on the Scots-L newsgroup.X:1
T:"Gigg" (next to last tune, following "The Low Lands of Holand")
S:CPC book II p36
Q:1/4=120
L:1/8
M:6/8
K:A mixolydian
E| A2 A  (Bc)e| f3    a3 |(ec)A (AB)c|(Bc)A (B^G)
E|(AB)A  (Bc)e| f3    a2f|(ec)A TB2 A| A3-   A2:|
e| a2 a (^ga)g|Tf3 {f}e2c| B2B  (Bc)e| a2^g Tf3 |
   a3    (ec)A|(Bc)e  f2a| efA  TB2 A| A3-   A2:|]Bayard also found the tune in the 2nd strain of "Dumfries House"
in vol. 1 of Gow's 'Complete Repository' (and this would have
been known to many fiddlers). After the 1st (1799)
edition this was attributed to John Riddle.X:2
T:Dumfries House [by Jo. Riddle - in 3rd ed]
S:Gow's 'Complete Repository, vol. 1 [1799 for 1st ed]
S:2nd strain only here
Q:1/4=120
L:1/8
M:6/8
K:G
B/c/|dBd dBd|gag "tr"f2e|dBd d3/2c/2B|AFDD2B/c/|dBd bBd|\
gag"tr"f2e|dcB AGF|"tr"G3/2G2B/c/|dBd dBd|gag"tr"f2e|\
dBd dcB|AFDD2B/c/|dBd ece|fdf gfe|dcB Agf|gdB G||Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Rosin the Beau
From: Murray Shoolbraid <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 26 Aug 2003 17:46:38 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(45 lines)


As an addendum to John Garst's interesting note, compare the following, from
Beadle's "Dime Song Book" No. 3 [N.Y.: Irwin P. Beadle, c. 1860], page 61.I've traveled this wide world over,
And now to another I'll go,
I know that good quarters are waiting
To welcome old Rosin the Beau.
To welcome old Rosin the Beau,[bis]
I know that good quarters are waiting
To welcome old Rosin the Beau.[Similarly:]When I'm dead and laid out on the counter,
A voice you will hear from below,
Singing out. "Whiskey and water,
To drink to old Rosin the Beau."And when I am dead, I reckon,
The ladies will all want to, I know,
Just lift off the lid of my coffin,
And look at old Rosin the Beau.You must get some dozen good fellows,
And stand them all round in a row,
And drink out of half-gallon bottles
To the name of old Rosin the Beau.Get four or five jovial young fellows.
And let them all staggering go,
And dig a deep hole in the meadow,
And in it toss Rosin the Beau.Then get you a couple of tombstones,
Place one at my head and my toe,
And not fail to scratch on it
The name of old Rosin the Beau.I feel the grim tyrant approaching,
The cruel implacable foe,
Who spares neither age nor condition,
Nor even old Rosin the Beau.- I notice Oscar Brand (Folk Songs for Fun, 1961, p. 142) is very close to
this, except he lacks stanza 7.

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bayard (was: Rosin the Beau (very long))
From: Nigel Gatherer <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 09:31:13 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(13 lines)


Bruce Olson wrote:> Bayard also found the tune in the 2nd strain of "Dumfries House"I think I'd enjoy reading Bayard, although I've never seen it. However,
many of the references I've seen linking this tune and that leave me
feeling somewhat suspicious. I consider some of links dubious - what's
your opinion, Bruce?--
Nigel Gatherer, Crieff, Scotland
[unmask]
http://www.argonet.co.uk/users/gatherer/

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 08:43:03 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(46 lines)


Nigel Gatherer wrote:
>
> Bruce Olson wrote:
>
> > Bayard also found the tune in the 2nd strain of "Dumfries House"
>
> I think I'd enjoy reading Bayard, although I've never seen it. However,
> many of the references I've seen linking this tune and that leave me
> feeling somewhat suspicious. I consider some of links dubious - what's
> your opinion, Bruce?
>
> --
> Nigel Gatherer, Crieff, Scotland
> [unmask]
> http://www.argonet.co.uk/users/gatherer/I only know that his reputation is Sterling, and I am much too
ignorant of music to be able to pass any independent judgement on
him. It is obvious that Bayard takes a very liberal view of what
he considers variants of the same tune.This takes us to the unfinished business of what is a 'tune
family' that Bayard was fond of (but gets no mention in 'Dance to
the Fiddle, March to the Fife'). Bertrand Bronson had to sidestep
this in 'The Traditional Tunes of then Child Ballads' because he
could get no comprehensive definition of the term. I have heard
that musicologists were working on this, but haven't seen that
anything much has yet been accomplished.Search on Google for 'Samuel P. Bayard' for references to some of
Bayard's other work on folk tunes. In an obituary of Bayard that I saw
on the internet, but can't now relocate, mention was made that at his
death he was well along on a work on the tunes of numerous folk songs
that he had collected. No mention was made there of any attempt by
anyone to bring this to completion.I am certain that there are others here that can comment on this
subject much more intelligently than I can, and I wish some would
do so.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: FWIW: Rosin the Beau (very long)
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 10:29:57 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


>John Garst wrote:
>>
>>  There has been some discussion on Fasola of SAWYER'S EXIT and Rosin
>>  the Beau (Bow).  FWIW, here is something on the latter song from
>>................
>
>>     Judge Clark suspected that if the tune was indeed "an old
>>  Methodist hymn tune" that the Methodists must have excommunicated it
>>  after it became associated with such rowdy, secular words.
>>
>>  --
>>  john garst    [unmask]
>
>What old Methodist hymn tune?Judge Clark does not specify.  He simply quotes an 1874 letter
written by Colonel W. H. Sparks, "he [Cox] fell upon the old
Methodist hymn tune in which they [the words of the poem] have ever
since been sung."  This would have been around 1830 or before.
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 10:55:16 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(30 lines)


Bruce Olson wrote:
>
> Nigel Gatherer wrote:
> >
> > Bruce Olson wrote:
> >
> > > Bayard also found the tune in the 2nd strain of "Dumfries House"
> >.............In 'The Critics and the Ballad', 1961, edited by MacEdward Leach
and Tristram P. Coffin, is an article by Samuel P. Bayard,
'Prolegomena to a Study of the Principle Melodic Families of Folk
Song'. This contains much discussion about similarities and
differences between tunes, but no precise methodology for
comparison of two tunes, or a basis for judgement as to whether
two tunes are variants based on such comparisons.Use Google to search for 'Tune Family' for a simple definition at
www.britannica.com. I can't see why my direct link won't
work for me. I can get all but the actual text. Maybe it will work
for you, so here it is:
<A href="http://www.britannica.com/article?eu=75687">Tune Family
</a>Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 11:06:29 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


Bruce Olson wrote:
>
> Nigel Gatherer wrote:
> >Correction:
<A href="http://www.britannica.com/eb/article?eu=75687"> Tune
Family </a>Bruce Olson

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Maggadee
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 11:31:39 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(88 lines)


Perhaps a year ago I heard Neal Pattman, a local blues singer, sing
"John Henry," including a verse I had not heard, or noticed, before.
This verse is of a common form but not a common content.  It is not
included in Art Rosenbaum's transcription of Neal's "John Henry" in
Art's and Margo's book, Folk Visions and Voices, nor is it included
in Neal's recording of "John Henry" issued on the Global Village CD,
The Blues Ain't Left Yet, Neal Pattman, CD 226.  What follows is not
an exact transcription but what Neal sings is similar.John Henry had a little woman,
  Maggadee was her name,
When John Henry took sick and went to bed
  Maggadee drove steel like a man.What impressed me earlier was John Henry's woman's name, "Maggadee,"
as I thought I heard it.  This is sufficiently close to "Maggie D," a
historically logical name, possibly, that I took it to be significant
and made a note to check the name with Neal.I had my chance last night.  He performed in an outdoor setting and
sang "John Henry" again, including that verse.  Also, I had a chance
to speak with him both before and after his performance.When I asked Neal what John Henry's woman's name was, he first said,
"Maggatee," giving the "t" a distinct enunciation, enough to
distinguish it from a "d."  Then, when he repeated it, he put it
extra syllables, "Magganatee."  In his singing, I again heard
"Maggadee," and so did my wife and a friend, whom I had primed to
listen carefully for John Henry's woman's name.Neal says that he learned "John Henry" from his father when he was 9
years old, the same year he lost his right arm as a result of a
neglected farming injury.  He was born in 1926, so this would have
been 1935.  Neal was one of 13 children.  I don't know where he falls
among them, so I can't readily estimate when his father was born, but
if we make Neal number 7 (middle) and allow an average of 18 months
between births, then he would be 9 years younger than the first
child, so the first child would have been born in about 1917.  That
suggests that Neal's father might have been born around 1900, though
he could have been born earlier, perhaps as early as 1885 or so.  In
any event, he probably learned "John Henry" by 1910.  If John Henry
died at Dunnavant, Alabama, in 1887, this would have been only 23
years later.  Neal's father's version, presumably preserved intact by
Neal, is probably an early one.Regardless of which version of John Henry's woman's name Neal
actually sings, "Maggadee," "Maggatee," or "Magganatee," it is a
plausible corruption of "Maggie D."Family history, in published memoirs, says that Phillip Augustine Lee
Dabney, of Raymond, Mississippi, had a slave boy named Henry who was
a teenager during the Civil War.  Census and marriage records show
that a black, 20-year-old Henry Dabney married Margaret Poston in
1870 in Copiah County, Mississippi.  She might have become known as
"Maggie D," "D" for "Dabney."P. A. L. Dabney's son, Frederick Yeamans Dabney, was a civil engineer
in the railroad construction business.  In 1886 he became Chief
Engineer for the Columbus & Western RR, a subsidiary of the Central
RR and Banking Company of Georgia, later (1895) to become Central of
Georgia.  Captain (Civil War rank) Dabney personally oversaw the
construction of the C & W line between Goodwater, Alabama, and
Birmingham in 1887-1888.  Local lore around Leeds, Alabama, says that
he brought John Henry with him from Mississippi to work on that job.
The contest with a steam drill is supposed, according to one account,
to have occurred on Tuesday, September 20, 1887.Perhaps the Henry Dabney who married Margaret was the slave boy and
also the legendary John Henry.  Perhaps Neal Pattman and his father
have preserved a name, "Maggie D," that has mutated in all other
versions known to me.Notice that Neal's line, "Maggadee was her name," contrasts in form
with the usual, "Her name was Polly Ann."  Neal makes "name" rhyme,
somewhat, with "man" by pronouncing the latter with a long "a,"
"main," just as in his performance of "I'm a Man."Although "Polly Ann" is the most common name one hears for John
Henry's wife/woman, in years past "Magdalene" or "Mary Magdalene"
were occasionally collected.  Here is a speculation."Maggie D" -> "Magdalene" -> "Mary Magdalene" -> "Polly Ann""Maggie D" suggests "Magdalene," which in turn suggests "Mary
Magdalene."  "Polly" is a nickname for "Mary," and "Polly Ann" is not
only a common combination but also it rhymes with "like a man."
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Short Notice Ebay Auction
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 12:58:33 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(15 lines)


Hi!        This item just appeared and is only a 3 day auction.        3547136825 - Traditional Ballads of Virginia by Davis, 1969,
$14.99 (ends Aug-29-03 14:55:14 PDT)                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Ed Cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 10:16:13 -0700
Content-Type:TEXT/PLAIN
Parts/Attachments:

TEXT/PLAIN(65 lines)


Nigel, Bruce et al:I concur with Bruce in his evaluation of Sam Bayard's reputation.  As I
recall from a conversation with him, he theorized that there were just 12
tune familes in the Anglo-American canon.  D.K. Wilgus -- help me here,
Norm Cohen -- thought there were 24 (?).I recall that Anne Shapiro wrote her doctoral dissertation on the subject.
I have a partial copy of that work, but it is at home and I am in my
office so I cannot summarize her conclusions.EdOn Wed, 27 Aug 2003, Bruce Olson wrote:> Nigel Gatherer wrote:
> >
> > Bruce Olson wrote:
> >
> > > Bayard also found the tune in the 2nd strain of "Dumfries House"
> >
> > I think I'd enjoy reading Bayard, although I've never seen it. However,
> > many of the references I've seen linking this tune and that leave me
> > feeling somewhat suspicious. I consider some of links dubious - what's
> > your opinion, Bruce?
> >
> > --
> > Nigel Gatherer, Crieff, Scotland
> > [unmask]
> > http://www.argonet.co.uk/users/gatherer/
>
> I only know that his reputation is Sterling, and I am much too
> ignorant of music to be able to pass any independent judgement on
> him. It is obvious that Bayard takes a very liberal view of what
> he considers variants of the same tune.
>
> This takes us to the unfinished business of what is a 'tune
> family' that Bayard was fond of (but gets no mention in 'Dance to
> the Fiddle, March to the Fife'). Bertrand Bronson had to sidestep
> this in 'The Traditional Tunes of then Child Ballads' because he
> could get no comprehensive definition of the term. I have heard
> that musicologists were working on this, but haven't seen that
> anything much has yet been accomplished.
>
> Search on Google for 'Samuel P. Bayard' for references to some of
> Bayard's other work on folk tunes. In an obituary of Bayard that I saw
> on the internet, but can't now relocate, mention was made that at his
> death he was well along on a work on the tunes of numerous folk songs
> that he had collected. No mention was made there of any attempt by
> anyone to bring this to completion.
>
> I am certain that there are others here that can comment on this
> subject much more intelligently than I can, and I wish some would
> do so.
>
> Bruce Olson
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> subject index) </a>
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 14:01:07 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(87 lines) , text/html(97 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 15:10:55 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(30 lines)


Ed Cray wrote:
>
> I recall that Anne Shapiro wrote her doctoral dissertation on the subject.
> I have a partial copy of that work, but it is at home and I am in my
> office so I cannot summarize her conclusions.
>
> Ed
> ......I think I've finally put 2 and 2 together.A nineteenth century Scots song and ballad collection from the Scottish
Text Society, 2002:
<A
href="http://www.scottishtextsociety.org/currenttitles.htm#HarrisSongs">
Click </a>  Click on top title to go back to ISBN #, and
ordering information.I think that last co-editor listed at the click-on, Anne Dhu
McLucas, ethnomusicologist and Dean of the Music Dept. of the U.
of Oregon, is the Anne Shapiro that Ed refers to above.Ed, can I trouble you for her thesis title?Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 15:20:25 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


dick greenhaus wrote:
>
> Why does this remind me of the remark: "If you've heard one Irish
> tune, you've heard them both.":?
>...
> dick greenhaus
>I've only noticed that for Kerry slides.I would certainly like to see Wilgus's 24 strains written out in music
notation so I could see some things for myself.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 15:37:40 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


>Why does this remind me of the remark: "If you've heard one Irish
>tune, you've heard them both.":?
>If one make the "family" definition broad enough, it becomes
>all-encompassing and all-useless.
>dick greenhausWhat may be needed is a measure of overlap, that is, the degree to
which two tunes are similar.  I don't think that the formulation of
such a measure would be an insurmountable problem.
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 15:46:52 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(18 lines)


Bruce Olson wrote:
><A href="http://oasis.harvard.edu/html/hou00178.html"> Harris MS
</a>
> A nineteenth century Scots song and ballad collection from the Scottish
> Text Society, 2002:
> <A
> href="http://www.scottishtextsociety.org/currenttitles.htm#HarrisSongs">
> Click </a>  Click on top title to go back to ISBN #, and
> ordering information.
>A bit of background on the STS volume, 2002.
<A href="http://oasis.harvard.edu/html/hou00178.html"> Harris MS
</a>Bruce Olson

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Ed Cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 14:25:21 -0700
Content-Type:TEXT/PLAIN
Parts/Attachments:

TEXT/PLAIN(17 lines)


On Wed, 27 Aug 2003, John Garst wrote:> >If one make the "family" definition broad enough, it becomes
> >all-encompassing and all-useless.
> >dick greenhaus
>
> What may be needed is a measure of overlap, that is, the degree to
> which two tunes are similar.  I don't think that the formulation of
> such a measure would be an insurmountable problem.
> --
> john garst    [unmask]John:You are welcome to try.Ed

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Bayard
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 23:20:22 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(38 lines)


> As I recall from a conversation with him, he theorized that
> there were just 12 tune familes in the Anglo-American canon.
> D.K. Wilgus - help me here, Norm Cohen - thought there were 24 (?).Something I have seen in print somewhere said that Bayard ended up
with 46 families.Phil Taylor (author of the Mac ABC program BarFly) is a former
computational geneticist, and tried using off-the-shelf gene-
comparison software to do tune comparisons on ABC instead of
codons.  The results were pretty reasonable for closely related
tunes: I gave him all the variants of "Mary Scott" I could find
(from the one in the Agnes Hume lute MS to the Kerr's version
of "The Smith's A Gallant Fireman") and the similarity rankings
the program came up with were much the same as a human would.
Whether the results would still be statistically significant at
a level of granularity that divided the whole repertoire into
46, 24 or 12 I rather doubt, but it might be worth somebody's
while trying.  The software is free and not hard to configure.
The hard bit would be assembling the corpus in the first place;
an ABC transcription of Bronson would be an essential starting
point.That might be one answer to a question I've had rattling around
my head since a thread here of a few weeks ago in which there
were comments about how *old* everybody here was (at age 54
I think I'm one of the youngsters):  What is there for a young
investigator in this field to do?  Not much fun starting in on
a subject where every conceivable angle has been covered by folks
old enough to be your grandparents.  Using new technologies for
corpus analysis (analyzing sound recordings too) is one possible
line, what are others?-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 17:53:29 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


Oh joy, at 53 I'm a youngster again!Jack Campin wrote:>(at age 54 I think I'm one of the youngsters)
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 18:50:47 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(44 lines)


On 8/27/03, Ed Cray wrote:>On Wed, 27 Aug 2003, John Garst wrote:
>
>> >If one make the "family" definition broad enough, it becomes
>> >all-encompassing and all-useless.
>> >dick greenhaus
>>
>> What may be needed is a measure of overlap, that is, the degree to
>> which two tunes are similar.  I don't think that the formulation of
>> such a measure would be an insurmountable problem.
>> --
>> john garst    [unmask]
>
>John:
>
>You are welcome to try.I have to agree. Think about this: How often have you heard
two tunes that are THE SAME (as far as sheet music goes)
and don't sound the same? :-)I've thought about this issue a lot. The problem is that you
have three "axes": Tones, timing -- and tune shape (2/4,
3/4, 9/8, etc., plus stresses and scales). And the three aren't
the same sort of variable. You can say that two tunes are
the same, or fundamentally similar, in one axis; this is
easy. (It really is.) But bringing the axes together is
almost impossible. Is "Yankee Doodle" still "Yankee Doodle"
if you play it as a slip jig? A Mixolydian tune may be
"the same" as an Ionian if you allow for flatted sevenths,
but is it really the same if you put it in Lydian mode?
Not to my ear.What it comes down to is, you can devise an arbitrary
measure of "sameness." It will be precise. But it won't
correspond to what we mean by "the same."--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: folkmusic <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 21:08:12 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(15 lines)


Bob Waltz wrote:> Is "Yankee Doodle" still "Yankee Doodle" if you play it as a slip jig? A
Mixolydian tune may be "the same" as an Ionian if you allow for flatted
sevenths, but is it really the same if you put it in Lydian mode?You might not even have to change meter or scale.  I did a concert last
night at South Street Seaport Museum as part of a group.  The lead singer
who preceeded me by 2 songs sang "The Diamond."  I sang a Monitor & Merrimac
ballad to the tune of "The Old Virginia Lowlands."  The melody in the verse
is the same in both songs, the chorus melody is different.  No one, audience
or singers, recognized it.All the best,
Dan Milner

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 22:02:51 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(102 lines)


Robert B. Waltz wrote:
>
> On 8/27/03, Ed Cray wrote:
>
> >On Wed, 27 Aug 2003, John Garst wrote:
> >
> >> >If one make the "family" definition broad enough, it becomes
> >> >all-encompassing and all-useless.
> >> >dick greenhaus
> >>
> >> What may be needed is a measure of overlap, that is, the degree to
> >> which two tunes are similar.  I don't think that the formulation of
> >> such a measure would be an insurmountable problem.
> >> --
> >> john garst    [unmask]
> >
> >John:
> >
> >You are welcome to try.
>
> I have to agree. Think about this: How often have you heard
> two tunes that are THE SAME (as far as sheet music goes)
> and don't sound the same? :-)
>
> I've thought about this issue a lot. The problem is that you
> have three "axes": Tones, timing -- and tune shape (2/4,
> 3/4, 9/8, etc., plus stresses and scales). And the three aren't
> the same sort of variable. You can say that two tunes are
> the same, or fundamentally similar, in one axis; this is
> easy. (It really is.) But bringing the axes together is
> almost impossible. Is "Yankee Doodle" still "Yankee Doodle"
> if you play it as a slip jig? A Mixolydian tune may be
> "the same" as an Ionian if you allow for flatted sevenths,
> but is it really the same if you put it in Lydian mode?
> Not to my ear.
>
> What it comes down to is, you can devise an arbitrary
> measure of "sameness." It will be precise. But it won't
> correspond to what we mean by "the same."
>
> --
> Bob Waltz
> [unmask]
>
> "The one thing we learn from history --
>    is that no one ever learns from history."What difference does Mixolydian or Ionian sound make if you're trying to
identify the tune, not the mode? Mode makes no difference as to tune
identity. Some tunes can be found in variants of as many as 4 modes
(ionian, mixolydian, dorian, and aeolian usually when this happens).
Play them in their different modes, and they will sound a bit different,
but will easily be identifiable as the same tune.With intelligent programing, the rhythm can be taken care of
automatically, except for very unusual cases. Use stressed notes.Then with dupple times one has 2 beats per time unit (occassionaly an
anomally since 4/8 time is always scored as 2/4, but see last sentence
below).The only other case is tripple per unit time, with 3 options. 1 beat per
time unit (here a measure) on simple 3/4 (stressed on first quarter note
in each measure); 2 for 3/2 (or 3/4) duple = half(quarter),
quarter(eighth), half(quarter), quarter(eighth). Else 3 per time unit,
start at 1st, 2nd, 3rd quarter note positions for 3/4; 1st, 3rd and 5th
quarter for 6/4 (eighths for 6/8); 9/8 each 3rd eighth note; for 12/8
just double 6/8. The ABC play program on my website will stressed note
code the ABCs. These timing options are already built into the stressed
note coding subroutine, so they are automatically determined from the
score.That 4/8 versus 2/4 is determined by how many notes greater than or = to
an eighth note there are in a measure, and the indicated measure time.[My program might not always do 5/4, 7/4, and other exotic timimgs
correctly].Take a look at the files on stressed note coding on my website.
I think I have simplied notation, and have as powerful a system as one
can do by these methods, but my way of coding is more time consuming
than those used on EASMES, and that in Charles Gore's 'The Scottish
Fiddle Music Index'. However, none of these systems work well for any
but small differences between variants.How big can differences be, and the tunes still be called variants of
the same tune? If I ever figure out Samuel P. Bayard's methodology I
might be able to give a bit of an answer to that. I've taken the first
step toward getting Anne Shapiro's thesis, in hopes it will give some
answers, or, at least, an intelligent guidance.Remember, the purpose these types of coding is to not to spell out minor
differences; it's to identify the tune, and find, by comparison, the
variants of it. Minor differences are already in the score, and those
are we what want to get rid of.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 22:37:43 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(67 lines)


On 8/27/03, Bruce Olson wrote:[ ... ]>What difference does Mixolydian or Ionian sound make if you're trying to
>identify the tune, not the mode? Mode makes no difference as to tune
>identity.But this is a blatant case of assuming the solution. What is "the same"?
I might recognize Ionian and Mixolydian versions of a tune as the
same. Ditto Dorian and Aeolian. But Ionian and Dorian? Not likely.
Maybe you hear them the same way -- but is it the same tune if most
people don't recognize it? This is not quibbling. Even if the
two derive from the same original, I don't say that's "the same."[ ... ]>With intelligent programing, the rhythm can be taken care of
>automatically, except for very unusual cases. Use stressed notes.This, again, ignores the problem of crossover between the several
variables. The question is NOT to define some "coefficient of
sameness." (At least, it's not what *I* was trying to do.) It's
to actually find a way to say that "over 50% of people would say
that Tune A is the same as Tune B, but Tune C is not the same as
Tune A." Note incidentally that it is possible that this
relationship does NOT follow the rules of algebra and logic --
that is, if we abbreviate "is the same as" as a mathematical
operator "ista," the statementsA ista B
and
B ista Cdoes NOT implyA ista C(although it increases the likelihood).[ ... ]>How big can differences be, and the tunes still be called variants of
>the same tune? If I ever figure out Samuel P. Bayard's methodology I
>might be able to give a bit of an answer to that.Understanding Bayard's ideas would be helpful. But I would deny
that this translates into actually knowing which songs are "the
same."Heck, we can't even agree which TEXTS are the same (witness the
people who say that "The Half-Hitch" is a version of "The Marriage
of Sir Gawain." Yeah, right). Musical notation is not adequate
even to convey the form of a single tune (note how often two
transcribers will change their rhythmic punctuation of a particular
melody). Can we then establish identity on that basis? At the
very least, the results need to be "people tested."Which might be a good place to start, actually: Building up a
library of materials and seeing how many people say they're
"the same."
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 00:22:56 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


----- Original Message -----
From: Clifford Ocheltree <[unmask]><<Oh joy, at 53 I'm a youngster again!>>Jack Campin wrote:>(at age 54 I think I'm one of the youngsters)
>
>Hurrah, hurray, I'm a child of 52! (Okay, 53 in two weeks.) Thank you, Jack,
for our new definition.Peace,
Paul

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 00:49:14 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


----- Original Message -----
From: Robert B. Waltz <[unmask]><<At the
very least, the results need to be "people tested."Which might be a good place to start, actually: Building up a
library of materials and seeing how many people say they're
"the same." >>With different groups of people -- naive subjects (non-musicians), savvy
subjects (folk musicians) and may-or-may-not-be-savvy subjects (non-folk
musicians).Some young squirt interested in a dissertation topic? Oh, I forgot, we're
the young squirts.Peace,
Paul

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard (was: Rosin the Beau (very long))
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 23:09:55 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(78 lines)


Sorry, I'm afraid I don't recall D.K.'s number; it probably varied with the
time of day and ....
Norm----- Original Message -----
From: "Ed Cray" <[unmask]>
To: <[unmask]>
Sent: Wednesday, August 27, 2003 10:16 AM
Subject: Re: Bayard (was: Rosin the Beau (very long))> Nigel, Bruce et al:
>
> I concur with Bruce in his evaluation of Sam Bayard's reputation.  As I
> recall from a conversation with him, he theorized that there were just 12
> tune familes in the Anglo-American canon.  D.K. Wilgus -- help me here,
> Norm Cohen -- thought there were 24 (?).
>
> I recall that Anne Shapiro wrote her doctoral dissertation on the subject.
> I have a partial copy of that work, but it is at home and I am in my
> office so I cannot summarize her conclusions.
>
> Ed
>
>
> On Wed, 27 Aug 2003, Bruce Olson wrote:
>
> > Nigel Gatherer wrote:
> > >
> > > Bruce Olson wrote:
> > >
> > > > Bayard also found the tune in the 2nd strain of "Dumfries House"
> > >
> > > I think I'd enjoy reading Bayard, although I've never seen it.
However,
> > > many of the references I've seen linking this tune and that leave me
> > > feeling somewhat suspicious. I consider some of links dubious - what's
> > > your opinion, Bruce?
> > >
> > > --
> > > Nigel Gatherer, Crieff, Scotland
> > > [unmask]
> > > http://www.argonet.co.uk/users/gatherer/
> >
> > I only know that his reputation is Sterling, and I am much too
> > ignorant of music to be able to pass any independent judgement on
> > him. It is obvious that Bayard takes a very liberal view of what
> > he considers variants of the same tune.
> >
> > This takes us to the unfinished business of what is a 'tune
> > family' that Bayard was fond of (but gets no mention in 'Dance to
> > the Fiddle, March to the Fife'). Bertrand Bronson had to sidestep
> > this in 'The Traditional Tunes of then Child Ballads' because he
> > could get no comprehensive definition of the term. I have heard
> > that musicologists were working on this, but haven't seen that
> > anything much has yet been accomplished.
> >
> > Search on Google for 'Samuel P. Bayard' for references to some of
> > Bayard's other work on folk tunes. In an obituary of Bayard that I saw
> > on the internet, but can't now relocate, mention was made that at his
> > death he was well along on a work on the tunes of numerous folk songs
> > that he had collected. No mention was made there of any attempt by
> > anyone to bring this to completion.
> >
> > I am certain that there are others here that can comment on this
> > subject much more intelligently than I can, and I wish some would
> > do so.
> >
> > Bruce Olson
> > --
> > Roots of Folk: Old British Isles popular and folk songs, tunes,
> > and broadside ballads at my no-spam website
> > <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> > subject index) </a>
> >
> >
> >
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 27 Aug 2003 23:10:46 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


I don't like the direction this thread is taking.
Norm----- Original Message -----
From: "Paul Stamler" <[unmask]>
To: <[unmask]>
Sent: Wednesday, August 27, 2003 10:22 PM
Subject: Re: Bayard> ----- Original Message -----
> From: Clifford Ocheltree <[unmask]>
>
> <<Oh joy, at 53 I'm a youngster again!>>
>
> Jack Campin wrote:
>
> >(at age 54 I think I'm one of the youngsters)
> >
> >
>
> Hurrah, hurray, I'm a child of 52! (Okay, 53 in two weeks.) Thank you,
Jack,
> for our new definition.
>
> Peace,
> Paul
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 03:39:19 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(136 lines)


Robert B. Waltz wrote:
>
> On 8/27/03, Bruce Olson wrote:
>
> [ ... ]
>
> >What difference does Mixolydian or Ionian sound make if you're trying to
> >identify the tune, not the mode? Mode makes no difference as to tune
> >identity.
>
> But this is a blatant case of assuming the solution. What is "the same"?
> I might recognize Ionian and Mixolydian versions of a tune as the
> same. Ditto Dorian and Aeolian. But Ionian and Dorian? Not likely.
> Maybe you hear them the same way -- but is it the same tune if most
> people don't recognize it? This is not quibbling. Even if the
> two derive from the same original, I don't say that's "the same."
>
> [ ... ]
>
> >With intelligent programing, the rhythm can be taken care of
> >automatically, except for very unusual cases. Use stressed notes.
>
> This, again, ignores the problem of crossover between the several
> variables. The question is NOT to define some "coefficient of
> sameness." (At least, it's not what *I* was trying to do.) It's
> to actually find a way to say that "over 50% of people would say
> that Tune A is the same as Tune B, but Tune C is not the same as
> Tune A." Note incidentally that it is possible that this
> relationship does NOT follow the rules of algebra and logic --
> that is, if we abbreviate "is the same as" as a mathematical
> operator "ista," the statements
>
> A ista B
> and
> B ista C
>
> does NOT imply
>
> A ista C
>
> (although it increases the likelihood).
>
> [ ... ]
>
> >How big can differences be, and the tunes still be called variants of
> >the same tune? If I ever figure out Samuel P. Bayard's methodology I
> >might be able to give a bit of an answer to that.
>
> Understanding Bayard's ideas would be helpful. But I would deny
> that this translates into actually knowing which songs are "the
> same."
>
> Heck, we can't even agree which TEXTS are the same (witness the
> people who say that "The Half-Hitch" is a version of "The Marriage
> of Sir Gawain." Yeah, right). Musical notation is not adequate
> even to convey the form of a single tune (note how often two
> transcribers will change their rhythmic punctuation of a particular
> melody). Can we then establish identity on that basis? At the
> very least, the results need to be "people tested."
>
> Which might be a good place to start, actually: Building up a
> library of materials and seeing how many people say they're
> "the same."
> --
> Bob Waltz
> [unmask]
>
> "The one thing we learn from history --
>    is that no one ever learns from history."We've used a lot of non-quantative language here before on many threads
regarding "same" and "variant" texts and tunes, because, as far as I
know, we don't have any quantitative language for such. I probably
should have said 'near variants of the same' rather than 'same' but this
still leaves us which how much difference does 'variant' and 'near
variant' imply? Your "version of" can also span a wide range of
interpretations. Can you point out any source of an accurate language to
use for such discussions as these?In hopes of finding out about the real 'incomparable fiddler'
Jack Latin/ Leighton/ Latten I once requested that our Ballad-L
member Jack Campin procure for me a copy of a song and its tune
from the Euing Music Library which was on a single sheet song
with music in their possession. I've already apologized to him
elsewhere for putting him to such pain in such a useless
endeavour (a rather wretched song, having nothing to do with Jack
Latin).Let's resort to experiment here as to the possibility of
recognizing a tune in Dorian and Ionian Mode using Jack's
transcriptions below. It does seem to me that I can recognize the
two scores below to be the 'same/near variants of the same' tune in
spite of the difference of mode and key. Anyone disagree?[Base and song text deleted here]GUL N.b.23(39) [Glasgow Univ Lib., Euing Music Lib.]Jack Latten's Courtship
Set for the German FluteX:1
T:Jack Latten's Courtship [Jack Latin]
S:transcribed from a single sheet song with music by Jack Campin
M:C|
L:1/8
K:Ador
G/A/ B/ c/ d g d B B g|d B B g d2 B2|G/A/ B/ c/ d g dB g f/g/|a A
A B c2 A2||
G/A/ B/ c/ d B e c dB|G/A/ B/c/ d B d2 B2|G/A/ B/c/ d B ec d B|c
A
A B c2 A2||
G B B B B B B2|G B B B c2 B2|G B B B B B B2|c A A B c2 A2||X:2
T:Flute [score at end, transcribed by Jack Campin]
M:C|
L:1/8
K:C
B/c/d/e/ fbfddb|fddb f2d2|B/c/d/e/ fbfd b a/b/|c'ccd e2 c2||
B/c/d/e/ fdgefd|B/c/d/e/ fd f2d2|B/c/d/e/ fdgefd|eccd e2c2||
Bddddd d2|Bddd e2d2|Bddddd d2|eccd e2c2||Bruce OlsonPS: For purposes of testing the ABC player program on my website, I've
copied the first ABC tune in Vol. 1 of Aird's 'Airs' from Jack Campin's
website, "The Ranting Highlandman (= "The White Cockade") and, keeping
the key the same, made copies in all 7 possible scoring modes, and
played them. All 7 (including Locrian) are easily recognizable to me as
the 'same/near variants of the same' tune.Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 10:47:00 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(46 lines)


> In hopes of finding out about the real 'incomparable fiddler'
> Jack Latin/ Leighton/ Latten I once requested that our Ballad-L
> member Jack Campin procure for me a copy of a song and its tune
> from the Euing Music Library which was on a single sheet song
> with music in their possession.
> Let's resort to experiment here as to the possibility of
> recognizing a tune in Dorian and Ionian Mode using Jack's
> transcriptions below. It does seem to me that I can recognize the
> two scores below to be the 'same/near variants of the same' tune in
> spite of the difference of mode and key. Anyone disagree?I concluded that the "flute" part was intended as a harmonization
in thirds - that is, it wasn't created to be an independent melody.
Here are the two parts zipped together with no alteration except to
the beaming.  This works in BarFly as is, and should produce a usable
score with any ABC application that can do multiple voices.  It's not
a particularly interesting arrangement (just a completely literal
transposition of the melody line), but then what would you expect
from something with a text like that?...X:1
T:Jack Latten's Courtship [Jack Latin]
S:transcribed from a single sheet song with music by Jack Campin
M:C|
L:1/8
V:1 midi program 1 71 transpose -12 % "clarinet" sound used for tenor voice
V:2 midi program 1 74               % "recorder" sound used for flute
K:Ador
[V:1] G/A/B/c/ dg dBBg|dBBg        d2B2|G/A/B/c/ dg dB gf/g/|aAAB  c2A2||
[V:2] B/c/d/e/ fb fddb|fddb        f2d2|B/c/d/e/ fb fd ba/b/|c'ccd e2c2||
%
[V:1] G/A/B/c/ dB ecdB|G/A/B/c/ dB d2B2|G/A/B/c/ dB ecdB    |cAAB  c2A2||
[V:2] B/c/d/e/ fd gefd|B/c/d/e/ fd f2d2|B/c/d/e/ fd gefd    |eccd  e2c2||
%
[V:1] GBBB        BBB2|GBBB        c2B2|GBBB        BB B2   |cAAB  c2A2||
[V:2] Bddd        ddd2|Bddd        e2d2|Bddd        dd d2   |eccd  e2c2||Flute transpositions of songs are common as footnotes to song sheets of
the period (I think it's from around 1760), but I don't recall seeing
any other where the flute was expected to harmonize with the voice.-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 08:13:11 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(55 lines)


On 8/28/03, Bruce Olson wrote:[ ... ]>We've used a lot of non-quantative language here before on many threads
>regarding "same" and "variant" texts and tunes, because, as far as I
>know, we don't have any quantitative language for such.Conceded.>I probably
>should have said 'near variants of the same' rather than 'same' but this
>still leaves us which how much difference does 'variant' and 'near
>variant' imply? Your "version of" can also span a wide range of
>interpretations. Can you point out any source of an accurate language to
>use for such discussions as these?No. If there is such, I don't know of it. That's the whole point.I'm generally all in favor of formal (i.e. mathematically
quantifiable) definitions. But it must always be remembered that
a definition is only *useful* if it corresponds to how we
perceive reality. If I say that "all tunes in 3/4 time
which start on the tonic and consist of sixteen bars are the
same," I've produced a formal definition. Is it correct?
Surely not. One can define a mathematical relation by any
means one wishes. If you choose a better definition than the
one I just did, we may learn something from it. If you want to
call the result "tune deviation" or some such, fine.But calling two things "the same" implies that people will
recognize them as the same. Are a child's block painted blue
and a block painted green the same? They are to a blind kid,
not to a sighted kid. To use such language requires us to
test it -- presumably, to create a corpus of tunes people
regard as "the same" and "different" (or, perhaps, "the same,"
"similar," and "different"), and THEN to look for mathematical
relations. And, once we've found the relations, use them to
test a different set of tunes, to see whether the formula and
real people agree on "sameness."Maybe Bayard did this. But I suspect his classification was
informal (though educated, which may be the worst possible
thing). In any case, it needs to be tested.BTW -- folks, I'm 41. Youngest age I've seen stated on this list so
far. Doesn't this indicate another problem which probably needs
higher priority than defining which tunes are the same? :-(
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Beth Brooks <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 08:52:39 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(61 lines)


I know some members have already stated that this thread is growing tiresome, but I'm 39 and am one of the "youngsters" looking to cook up a dissertation in the near future. I have learned a great deal from the list so far!Beth Brooks
Indiana University>>> [unmask] 08/28/03 08:46 AM >>>
On 8/28/03, Bruce Olson wrote:[ ... ]>We've used a lot of non-quantative language here before on many threads
>regarding "same" and "variant" texts and tunes, because, as far as I
>know, we don't have any quantitative language for such.Conceded.>I probably
>should have said 'near variants of the same' rather than 'same' but this
>still leaves us which how much difference does 'variant' and 'near
>variant' imply? Your "version of" can also span a wide range of
>interpretations. Can you point out any source of an accurate language to
>use for such discussions as these?No. If there is such, I don't know of it. That's the whole point.I'm generally all in favor of formal (i.e. mathematically
quantifiable) definitions. But it must always be remembered that
a definition is only *useful* if it corresponds to how we
perceive reality. If I say that "all tunes in 3/4 time
which start on the tonic and consist of sixteen bars are the
same," I've produced a formal definition. Is it correct?
Surely not. One can define a mathematical relation by any
means one wishes. If you choose a better definition than the
one I just did, we may learn something from it. If you want to
call the result "tune deviation" or some such, fine.But calling two things "the same" implies that people will
recognize them as the same. Are a child's block painted blue
and a block painted green the same? They are to a blind kid,
not to a sighted kid. To use such language requires us to
test it -- presumably, to create a corpus of tunes people
regard as "the same" and "different" (or, perhaps, "the same,"
"similar," and "different"), and THEN to look for mathematical
relations. And, once we've found the relations, use them to
test a different set of tunes, to see whether the formula and
real people agree on "sameness."Maybe Bayard did this. But I suspect his classification was
informal (though educated, which may be the worst possible
thing). In any case, it needs to be tested.BTW -- folks, I'm 41. Youngest age I've seen stated on this list so
far. Doesn't this indicate another problem which probably needs
higher priority than defining which tunes are the same? :-(
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 10:03:02 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(4 lines)


Does everyone agree that the usual melody for "Rose Connoly" is the
"same" as that for "Rosin the Beau"?
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Elizabeth Hummel <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 10:36:44 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(71 lines)


Hmmm....Well I think I maybe the "child" of the list,  barely out of the cradle at 27!Liz HummelImage 4I know some members have already stated that this thread is growing tiresome, but I'm 39 and am one of the "youngsters" looking to cook up a dissertation in the near future. I have learned a great deal from the list so far!Beth Brooks
Indiana University>>> [unmask] 08/28/03 08:46 AM >>>
On 8/28/03, Bruce Olson wrote:[ ... ]>We've used a lot of non-quantative language here before on many threads
>regarding "same" and "variant" texts and tunes, because, as far as I
>know, we don't have any quantitative language for such.Conceded.>I probably
>should have said 'near variants of the same' rather than 'same' but this
>still leaves us which how much difference does 'variant' and 'near
>variant' imply? Your "version of" can also span a wide range of
>interpretations. Can you point out any source of an accurate language to
>use for such discussions as these?No. If there is such, I don't know of it. That's the whole point.I'm generally all in favor of formal (i.e. mathematically
quantifiable) definitions. But it must always be remembered that
a definition is only *useful* if it corresponds to how we
perceive reality. If I say that "all tunes in 3/4 time
which start on the tonic and consist of sixteen bars are the
same," I've produced a formal definition. Is it correct?
Surely not. One can define a mathematical relation by any
means one wishes. If you choose a better definition than the
one I just did, we may learn something from it. If you want to
call the result "tune deviation" or some such, fine.But calling two things "the same" implies that people will
recognize them as the same. Are a child's block painted blue
and a block painted green the same? They are to a blind kid,
not to a sighted kid. To use such language requires us to
test it -- presumably, to create a corpus of tunes people
regard as "the same" and "different" (or, perhaps, "the same,"
"similar," and "different"), and THEN to look for mathematical
relations. And, once we've found the relations, use them to
test a different set of tunes, to see whether the formula and
real people agree on "sameness."Maybe Bayard did this. But I suspect his classification was
informal (though educated, which may be the worst possible
thing). In any case, it needs to be tested.BTW -- folks, I'm 41. Youngest age I've seen stated on this list so
far. Doesn't this indicate another problem which probably needs
higher priority than defining which tunes are the same? :-(
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 10:45:16 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(92 lines) , text/html(102 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 10:50:41 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(25 lines) , text/html(21 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 10:55:25 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(36 lines)


Robert B. Waltz wrote:
>
>
>             Are a child's block painted blue
> and a block painted green the same? They are to a blind kid,
> not to a sighted kid.
> --
> Bob Waltz
> [unmask]Take a look at 'same' in a good dictionary. 'Identical' is the primary,
but not the only allowed definition, and one has some
leeway to interpret alternative definitions as one would like (e.g.,
'like in kind'). [For some reason I get scared when I think of the
possibility of a precise language in a mathematically sense. Irrational,
yes, but I do enjoy being irrational at times.]Incidently, I'm colorblind, so your painted blocks are all the same
(not really completely, but I would probably call some 'same' that you
wouldn't).On a trip to Europe in 1972 I got involved in a discussion of languages
(with all knowing Engish, but to few was it their native language), and
I advanced the opinion that English had so many words that were nearly
the same that is was easy to make oneself basically understood without
having to be precise. That was OK, but when I gave the further opinion
that it was difficult to be precise in English I really got shot down.
Most others said being precise was easier in English than any other
language that they knew of.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: New Bayard (only)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 11:16:30 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(47 lines)


Re: Jack LatinJack Campin wrote:
>
> >
> I concluded that the "flute" part was intended as a harmonization
> in thirds - that is, it wasn't created to be an independent melody.
> Here are the two parts zipped together with no alteration except to
> the beaming.  This works in BarFly as is, and should produce a usable
> score with any ABC application that can do multiple voices.  It's not
> a particularly interesting arrangement (just a completely literal
> transposition of the melody line), but then what would you expect
> from something with a text like that?...
>> Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
>.....Instead of just listening to the normal and flute scores as I
originally gave them (ADor and Cion), I've now used the ABC
player program on my website to make a graph of note frequency
(vertical) versus total time to note (horizontal). (Sorry, I don't know
how to copy it and post it.) [If you download the program you can do the
same.] Offsetting the lower (#1, normal) score up to overlap the upper
(#2, flute) shows that the last 1/3 of the two scores (measures 9-12)
are quite different. Below, we will return to this.The first 8 measures show many differences. The small ones I take
to be from the mode difference, and the larger ones (almost
always the same difference) I would take to be harmonic
substitutions. In spite of the differences, the similarities are
striking, and I think it's clear that the first 8 measures
are reasonably close variants of the 'same' melody for the two
scores (if we leave 'variant' imprecisely defined). Going back
now to measures 9-12, most of the differences here are the same
as the big ones in the first 8 measures, so the flute score here,
seems to me to be nearly pure harmonization with the normal score.I've done little such previously with what is possibly a new technique,
so I can't be very confident of my interpretation.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Elizabeth Hummel <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 11:20:09 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(39 lines) , text/html(36 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 11:54:48 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(52 lines)


dick greenhaus wrote:
>
> For an example of how modality can affect tune recognition, consider
> "The Red-Haired Boy (Gobby-O)" and "Gilderoy".
> Clearly related; different modes.
>
> dick greenhaus
>.......From my website:X:1
T:T062- The Gobby O
S:Aird's Airs, IV (c 1794)
Q:1/4=120
L:1/8
M:6/8
K:Am
B|c2A AcA|E2AA2c|B2G GBc|dBG GAB|c2A AcA|E2AA2f|edc BAB|\
E2AA2::B|A2Bc2d|e2^fg3|^faf gfe|dBGG2B|A2Bc2d|e2^f aga|\
edc BAc|E2AA2:|]X:2
T:B159-  Gilderoy
S:Stuart's 'Musick' (for TTM), c 1726
Q:1/4=120
L:1/4
M:C
K:Am
E|A3/2B/2 (c/2B/2)(c/2d/2)|ed/2c/2dc/2d/2|\
eG(c/2A/2)(G/2E/2)|G3/2A/2Gc/2B/2|\
(A/2^G/2)(A/2B/2) (c/2B/2)(c/2d/2)|\
ed/2c/2df|e(d/2c/4B/4)cB/2A/2|A2A||e/2f/2|\
g3/2a/2 (g/2f/2)(e/2d/2)|(f/2e/2)(d/2c/2)dc/2d/2|\
eG(c/2A/2)(G/2E/2)|G3/2A/2Ge/2f/2|\
g3/2a/2 (g/2f/2)(e/2d/2)|(f/2e/2)(d/2c/2)df|\
e(d/2c/4B/4) (c/2d/2) B/2A/2|A2A|]Dick, sure you've got the right tunes? I suspect you were given a
mis-labeled tune somewhere along the line.
Stressed notes codes for these two tunes are in file COMBCOD3.TXT on my
website, and could hardly be more different. Plotting them (with program
CODEDSP9.EXE on my website) we can get close to the
"Gilderoy" one by reflection of the "Gobby O" one off of a
horizontal mirror. ["Gobby O" is close to "Gilderoy" upside-down]Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 12:08:23 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(50 lines)


dick greenhaus wrote:
>
> For an example of how modality can affect tune recognition, consider
> "The Red-Haired Boy (Gobby-O)" and "Gilderoy".
> Clearly related; different modes.
>
> dick greenhausFrom my website:X:1
T:T062- The Gobby O
S:Aird's Airs, IV (c 1794)
Q:1/4=120
L:1/8
M:6/8
K:Am
B|c2A AcA|E2AA2c|B2G GBc|dBG GAB|c2A AcA|E2AA2f|edc BAB|\
E2AA2::B|A2Bc2d|e2^fg3|^faf gfe|dBGG2B|A2Bc2d|e2^f aga|\
edc BAc|E2AA2:|]X:2
T:B159-  Gilderoy
S:Stuart's 'Musick' (for TTM), c 1726
Q:1/4=120
L:1/4
M:C
K:Am
E|A3/2B/2 (c/2B/2)(c/2d/2)|ed/2c/2dc/2d/2|\
eG(c/2A/2)(G/2E/2)|G3/2A/2Gc/2B/2|\
(A/2^G/2)(A/2B/2) (c/2B/2)(c/2d/2)|\
ed/2c/2df|e(d/2c/4B/4)cB/2A/2|A2A||e/2f/2|\
g3/2a/2 (g/2f/2)(e/2d/2)|(f/2e/2)(d/2c/2)dc/2d/2|\
eG(c/2A/2)(G/2E/2)|G3/2A/2Ge/2f/2|\
g3/2a/2 (g/2f/2)(e/2d/2)|(f/2e/2)(d/2c/2)df|\
e(d/2c/4B/4) (c/2d/2) B/2A/2|A2A|]Dick, your tune names can't be right. Stressed notes codes for
these tunes are in file COMBCOD3.TXT on my website, and could
hardly be more different. Plotting them (with program
CODEDSP9.EXE on my website) we can get close to the
"Gilderoy" one by reflection of the "Gobby O" one off of a
horizontal mirror. ["Gobby O" is close to "Gilderoy" upside-down]Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 13:05:56 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(69 lines) , text/html(78 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: bennett schwartz <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 14:10:01 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(18 lines)


All of this stuff has been over my head but I can't imagine the sense in
which the melodies of "Rosin the Beau" and "Rose Connelly" are the same.
The first two lines are close enough and so is the last.  Otherwise, even
aside from the verse structure being different, I can't hear any of the
third line of "Rose Connelly" in what's left of "Rosin the Beau".
What am I missing here?
----- Original Message -----
From: "John Garst" <[unmask]>
To: <[unmask]>
Sent: Thursday, August 28, 2003 10:03 AM
Subject: Re: Bayard> Does everyone agree that the usual melody for "Rose Connoly" is the
> "same" as that for "Rosin the Beau"?
> --
> john garst    [unmask]
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 14:37:49 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


>All of this stuff has been over my head but I can't imagine the sense in
>which the melodies of "Rosin the Beau" and "Rose Connelly" are the same.
>The first two lines are close enough and so is the last.  Otherwise, even
>aside from the verse structure being different, I can't hear any of the
>third line of "Rose Connelly" in what's left of "Rosin the Beau".
>What am I missing here?Maybe nothing, but I think that the first, second, and last (double)
phrases are identical and the third (double) ones are closely related.
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: BBC Archives
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 13:41:53 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


This could prove to be very interesting:** BBC To Put Huge Archive OnlineThe Independent ( http://news.independent.co.uk/uk/media/story.jsp?story=436915 )
is one of the many places reporting that the BBC is planning to put a giant television and radio archive online. This project will be called the BBC Creative Archive. According to the BBC's statement about it (
http://news.bbc.co.uk/1/hi/entertainment/tv_and_radio/3177479.stm ),
"The service, the BBC Creative Archive, would be free and available to everyone, as long as they were not intending to use the material for commercial purposes." There is no clear date on when this archive will be available.There's some good Weblog commentary on this news at
http://www.hangingday.co.uk/archives/000603.shtml and
http://www.oblomovka.com/entries/2003/08/24#1061749500 .

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 13:52:58 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


On 8/28/03, John Garst wrote:>Does everyone agree that the usual melody for "Rose Connoly" is the
>"same" as that for "Rosin the Beau"?If you hadn't pointed it out, I would never have noticed any
similarity between the two other than being in triple time.Of course, I may know a different "Rose Connoly" tune than you
do (I would assume we know the same "Rosin the Beau").
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 14:01:08 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(47 lines)


On 8/28/03, Bruce Olson wrote:>Robert B. Waltz wrote:
>>
>>
>>             Are a child's block painted blue
>> and a block painted green the same? They are to a blind kid,
>> not to a sighted kid.
>> --
>> Bob Waltz
>> [unmask]
>
>Take a look at 'same' in a good dictionary. 'Identical' is the primary,
>but not the only allowed definition, and one has some
>leeway to interpret alternative definitions as one would like (e.g.,
>'like in kind'). [For some reason I get scared when I think of the
>possibility of a precise language in a mathematically sense. Irrational,
>yes, but I do enjoy being irrational at times.]We're still talking past each other, and I don't know how to make
this clearer. The precise definition of "same" is not at issue;
I'm willing to allow, e.g., that "Roll On, Columbia" is the same
as "Goodnight Irene" even though a few notes are changed. I'm
not willing to allow that "Goodnight Irene" is the same as "My
Bonnie," even though they too have been equated. How do I know?
I just do.You can try to measure "sameness" somehow, by some mathematical
or other definition -- but if you just say "X and Y are the
same because they share this, that, and the other characteristic,"
you aren't showing they're "the same"; you're showing that they
share those characteristics. Sameness is a common sense
commodity; a person will say that two tunes are the same, or
they aren't, and any measure of sameness has to produce nearly
the same result as the common-sense definition, no matter how
strange the latter may be.A formula may help us trace tunes' histories (though I have
doubts even about that), but it's just a formula until and
unless it agrees with our common sense.--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 15:32:57 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(82 lines)


dick greenhaus wrote:
>
> Bruce-
> Your comments reflect what I was saying--I'm not sure abot the ABCs
> you sent (I haven't had time to decode them yet) but listeners have no
> trouble seeing that they're closely related, although they seem to
> have virtuallyt no stressed notes in common.
> dick
>
> Bruce Olson wrote:
>
>      dick greenhaus wrote:
>
>
>           For an example of how modality can affect tune
>           recognition, consider
>           "The Red-Haired Boy (Gobby-O)" and "Gilderoy".
>           Clearly related; different modes.
>
>           dick greenhaus
>           .......Dick,We've still got a tune title mix-up here. Let's start over, and
keep it simple and direct.X:1
T:T062- The Gobby O
S:Aird's Airs, IV (c 1794)
Q:1/4=120
L:1/8
M:6/8
K:Am
B|c2A AcA|E2AA2c|B2G GBc|dBG GAB|c2A AcA|E2AA2f|edc BAB|\
E2AA2::B|A2Bc2d|e2^fg3|^faf gfe|dBGG2B|A2Bc2d|e2^f aga|\
edc BAc|E2AA2:|]X:2
T:B159-  Gilderoy
S:Stuart's 'Musick' (for TTM), c 1726
Q:1/4=120
L:1/4
M:C
K:Am
E|A3/2B/2 (c/2B/2)(c/2d/2)|ed/2c/2dc/2d/2|\
eG(c/2A/2)(G/2E/2)|G3/2A/2Gc/2B/2|\
(A/2^G/2)(A/2B/2) (c/2B/2)(c/2d/2)|\
ed/2c/2df|e(d/2c/4B/4)cB/2A/2|A2A||e/2f/2|\
g3/2a/2 (g/2f/2)(e/2d/2)|(f/2e/2)(d/2c/2)dc/2d/2|\
eG(c/2A/2)(G/2E/2)|G3/2A/2Ge/2f/2|\
g3/2a/2 (g/2f/2)(e/2d/2)|(f/2e/2)(d/2c/2)df|\
e(d/2c/4B/4) (c/2d/2) B/2A/2|A2A|]X:3
T:The Redhaired Boy
S:O'Neill's 'Music of Ireland', #1748
Q:1/4=120
L:1/16
M:2/4
K:A
(AG)|EAAG ABcd|efec d2(cd)|edcB ABcA|BGEF G2(ED)|EAAG ABcd|\
efec d2(cd)|eaab aged|c2A2 A2:|\
(ef)gfga g2(ef)|gfec d2(cd)|edcB ABcA|BGEF G2(ED)|EAAG ABcd|\
efec d2(cd)|eaab aged|c2A2 A2:|]"The Redhaired Boy" (major mode) is a variant of "Gilderoy"
(minor mode).
"The Gobby O" is not a variant of "Gilderoy" (or "Redhaired Boy"").To see this very directly use the ABC player program on my
website, and use it to plot a graph of log frequency (vertically)
versus time (horizontally) for all three of the above tunes
simultaneously.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 18:09:25 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(101 lines) , text/html(109 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 19:43:02 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(53 lines)


Robert B. Waltz wrote:> Sameness is a common sense commodity;
> a person will say that two tunes are the same, or
> they aren't, and any measure of sameness has to produce nearly
> the same result as the common-sense definition, no matter how
> strange the latter may be.
>
> A formula may help us trace tunes' histories (though I have
> doubts even about that), but it's just a formula until and
> unless it agrees with our common sense.
>
> --
> Bob Waltz'Common sense' is a self-adulation concept that one shares with
his peers, and is derived almost solely from that peer group.It has been said that "One man's common sense is another man's
chaos". Had we all 'common sense' we wouldn't have wars.Keep your common sense. I just want good data. (I'm experimentalist 1st,
analysist 2nd, and theoretician last.) I'll try, but probably never get
far, to devise scientific methodology, starting from an experimental,
not theoretical approach (my forte since 1960, and essentially that
recommended in the following).'Common-sense' was dispensed with in a long note 'A word on
hypothesis', by Anne and Norm Cohen in 'The Journal of American
Folklore', #344, April-June, pp. 156-60, 1974. (The brief outline
in this long note about the way good science really works is one I
heartily recommend that one study. This is not an outsider's
theoretical view of how he thinks science should work, it's the
"real McCoy".)Quoting the Cohens from JAF, p. 158:"To reiterate our own position, however, we see no need for
qualifying folklore (or folkloristics) as a science. It is
sufficient that the discipline distinguish itself by following
the path of scientific inquiry rather than common-sense inquiry,
and this is an approach that can be taken by textually oriented
or behaviorally oriented folklorists alike."Norm Cohen, do you have you any subsequent additions or revisions
you'd like to add?Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 28 Aug 2003 20:04:42 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(39 lines)


On 8/28/03, Bruce Olson wrote:>Robert B. Waltz wrote:
>
>> Sameness is a common sense commodity;
>> a person will say that two tunes are the same, or
>> they aren't, and any measure of sameness has to produce nearly
>> the same result as the common-sense definition, no matter how
>> strange the latter may be.
>>
>> A formula may help us trace tunes' histories (though I have
>> doubts even about that), but it's just a formula until and
>> unless it agrees with our common sense.
>>
>> --
>> Bob Waltz
>
>'Common sense' is a self-adulation concept that one shares with
>his peers, and is derived almost solely from that peer group.
>
>It has been said that "One man's common sense is another man's
>chaos". Had we all 'common sense' we wouldn't have wars.This is once again to DODGE.If you come up with any rule that says, Tune A is the same as
Tune B, and everyone says it's not the same, IT'S NOT THE
SAME.I don't care what the sorting criterion is. I don't care if it's
scientific or not (though I won't believe it if it isn't
scientific). Tunes are the same because people agree they're
the same. That's it.
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 10:55:58 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(48 lines)


> Sameness is a common sense commodity; a person will say that two
> tunes are the same, or they aren't, and any measure of sameness
> has to produce nearly the same result as the common-sense definition,
> no matter how strange the latter may be.
> A formula may help us trace tunes' histories (though I have
> doubts even about that), but it's just a formula until and
> unless it agrees with our common sense.There are two DIFFERENT concepts of sameness involved here.  You're
talking about perceived sameness, which is a pretty tough one to
provide theoretical explanations for.  Bruce is talking about
(various kinds of) objective information-theoretic similarity,
which may or may not correlate with perceived similarity but is
more likely to relate to the historical facts.One sort of situation where this will come up is when tune A has
been borrowed from culture X across a cultural boundary marked by
political, religious or ethnic hostility to become tune B in
culture Y.  To an outsider, A and B are the same tune.  To someone
within culture Y - how could you dare suggest such a thing, X's
culture is rubbish and has had no influence on ours at all.  You
aren't going to get a formal model of that process.I recall getting into an argument on Usenet once with someone of
the Celtic-is-the-greatest-the-English-are-all-bastards school of
thought about the origins of the Gaelic song tune "Chi mi na Mor-
Bheanna", "The Mist Covered Mountains".  I pointed out that it was
derived from the English "Johnny's too long at the fair"; she wasn't
having it, as nothing was to be allowed to detract from the total
originality and autonomy of Celtic culture, and she couldn't see
any resemblance between the two.  This despite the fact that in the
original Gaelic publication of the words the author said to use
"Johnny's too long at the fair" for it, naming the tune in English;
what did he know...I spent most of my life thinking that "The Minstrel Boy" and "The
Girl I Left Behind Me" were the same tune.  I first heard both at
around the same time, on the radio when I was about six, and somehow
never got round to separating them in my mind.  Apart from metre
they don't have a lot in common.  The explanation of the perceived
identity here has to be from my psychology and personal history, not
from any formal similarity.-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Apologies to All (Was: Re: Bayard)
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 07:55:45 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


I've been thinking about what I wrote last night, and want to
apologise to Bruce Olson and to the list. I spoke much too
strongly. (I can only confess to having been on the computer
for most of the past twelve hours before I wrote what I wrote.)I stand by the statement that "sameness" must be defined
by what human beings collectively perceive. But I could
have said it in a quieter tone of voice.--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 08:42:17 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(55 lines)


On 8/29/03, Jack Campin wrote:> > Sameness is a common sense commodity; a person will say that two
>> tunes are the same, or they aren't, and any measure of sameness
>> has to produce nearly the same result as the common-sense definition,
>> no matter how strange the latter may be.
>> A formula may help us trace tunes' histories (though I have
>> doubts even about that), but it's just a formula until and
>> unless it agrees with our common sense.
>
>There are two DIFFERENT concepts of sameness involved here.  You're
>talking about perceived sameness, which is a pretty tough one to
>provide theoretical explanations for.  Bruce is talking about
>(various kinds of) objective information-theoretic similarity,
>which may or may not correlate with perceived similarity but is
>more likely to relate to the historical facts.You are of course correct (though you're responding to the
wrong person here). But this still doesn't get to the root of
the problem. There are two parts. The first is historical
continuity. Take a case: Is "High Barbary" the same song
as "The George Aloe and the Sweepstake"? There is historical
continuity -- but there is also recension: Charles Dibdin
rewrote the latter to produce the former. Same song? Uh....The one clear answer I can give to that is that classical
scholars are now universally agreed: When a manuscript
work exists in several different recensions (rewrites),
they should NOT be edited into one. You print the "A"
text, or the "C" text, but you don't combine them. They
are "editions of" the same work, but they are not "the
same" work.Classifying by some method other than having people say,
"yes, that's the same tune" has historical value -- though
even should be verified. (There is no law that says two
tunes can't evolve independently. It won't happen often.
But tunes are relatively simple, compared to, say, the
complete works of Shakespeare, and we all know about the
monkeys and Shakespeare.) But if one says two tunes are
"the same," without qualification, people naturally
will expect that they will sound the same to them.If you say two tunes fall into the same TYPE, that's
a different matter, implying neither identity of origin
nor identity of history. That is useful research (though
I'd like to see the mathematical rules one uses). But
that sort of classification doesn't really imply anything
except what it says: Same TYPE of tune.
--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Apologies to All (Was: Re: Bayard)
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 11:04:51 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(13 lines)


>..."sameness" must be defined
>by what human beings collectively perceive....
>
>Bob WaltzIt is my observation, I think, that people will often not recognize
similarities between tunes until they are pointed out.  Then they
will have one of two reactions: (a) "That's amazing!  I never
realized it before."  (b) "No!  These tunes are different."
Suppliers of reaction (b) will often stubbornly stick to their view
no matter how many specific similarities are pointed out to them.
--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bill McCarthy <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 11:07:00 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(64 lines)


Dear Folks,When we talk about tunes being the same, we are entering into a
conversation that has been going on for quite a while.   They chose those
words to express a perception, and we enter the conversation because we
want to discuss that perception. I think we have to use the words,
therefore, in the way that the people who started the conversation used
them. Else why enter the conversation?What Bayard (whom I used to visit regularly in his office) and others were
interested in, I think, was descent, evolution, familial relationship among
various renditions of a tune idea.  Sometimes he used the term tune family
to express that relationship, as did Bronson.The discussion is not about songs, but about tunes.  Tunes, as we know, can
go with different songs.  Only recently, for example, have I noticed the
connection between Streets of Laredo and Bard of Armagh, and between
Twinkle Twinkle Little Star and the Alphabet Song.  Clearly, in cases like
these, someone used one familiar tune to set a different set of words.  And
people familiar with Irish and American folksong can think of many similar
cases.We also know that in oral tradition a person who learns a song can learn
the tune in a distinctly different way from the way the person who sang it
to him/her sang it.  I, for instance, long sang Banks of Ohio in 3/4 time
because I don't have a great sense of rhythm, and I thought that was the
way I was hearing it..  I also tended to even out the rhythm of other
songs.  And  I am not peculiar in this regard.  3/4 time versions of that
tune idea are also found in field collections.  It is also common to change
intervals, especially odd intevals, to more familiar intervals (a 7th to a
6th or 5th, but also a 5th to a 3rd, etc,) go from chromatic to pentatonic
or the other way, drop phrases of the tune and substitute repetition of the
first phrase, rearrange phrases, go from authentic to plagal, shift mode
(especially if one is using a guitar and singer one learned the song from
sang unaccompanied) and perform many other operations on the tune, all
quite unconscious.  The sum total of these changes, over time, can produce
variants far removed from the shape of the tune in 16th or 17th
century.  (We also know what jazz and blues musicians do with tunes)But within this conversation, using the word "same" the way it is used in
this conversation, we can say that these many variants are variants of the
same tune.  And people trained to look for such connections, or with
certain types of very good ears, can hear the connections -- though a tin
ear like mine took many years to perceive the tune connection between Bard
of Armagh and Streets of Laredo, though I am very fond of both songs.So I think Bayard and Wilgus and Bronson were asserting a historical
connection from signer to singer when they spoke of tune families or "the
same tune."  But the terms are not defined precisely.  Indeed, there is an
element of speculation in all this:  How can we __prove__ that a certain
melody derives from another melody if we were not there when that certain
melody was first sung, to question the singer (or fiddler or
whistler)?  And so there is probably no way to define the term
operationally or "scientifically."  It is perfectly conceivable that a
convergence from two distinct source tunes might produces two tunes that
are not "the same" in the sense I have just used it, but are measurably
more alike than are two other tunes that are in fact variants of one and
the same source tune.-- Bill McCarthyBill McCarthy

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Apologies to All (Was: Re: Bayard)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 10:46:42 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


----- Original Message -----
From: John Garst <[unmask]>>..."sameness" must be defined
>by what human beings collectively perceive....
>
>Bob Waltz<<It is my observation, I think, that people will often not recognize
similarities between tunes until they are pointed out.  Then they
will have one of two reactions: (a) "That's amazing!  I never
realized it before."  (b) "No!  These tunes are different."
Suppliers of reaction (b) will often stubbornly stick to their view
no matter how many specific similarities are pointed out to them.>>Indeed. I had the (a) reaction when my girlfriend pointed out that two tunes
I'd known for decades -- "Boll Weevil" as sung by Lead Belly and the most
common pop version of "Frankie and Johnny" were very close to being the same
tune.Peace,
Paul
Just a-lookin' for a home,
But he was doin' her wrong--
john garst    [unmask]

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Apologies to All (Was: Re: Bayard)
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 09:15:09 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(40 lines)


Paul:Woody Guthrie was a great borrower, often unaware he had done so.  Leadbelly's "Goodnight, Irene" furnished the tune for "Roll on, Columbia" -- a fact Guthrie didn't realize until Pete Seeger pointed it out.  ('Course, neither Guthrie nor Ledbetter gave a rat's ass about the "theft.")Ed----- Original Message -----
From: Paul Stamler <[unmask]>
Date: Friday, August 29, 2003 8:46 am
Subject: Re: Apologies to All (Was: Re: Bayard)> ----- Original Message -----
> From: John Garst <[unmask]>
>
>
> >..."sameness" must be defined
> >by what human beings collectively perceive....
> >
> >Bob Waltz
>
> <<It is my observation, I think, that people will often not recognize
> similarities between tunes until they are pointed out.  Then they
> will have one of two reactions: (a) "That's amazing!  I never
> realized it before."  (b) "No!  These tunes are different."
> Suppliers of reaction (b) will often stubbornly stick to their view
> no matter how many specific similarities are pointed out to them.>>
>
> Indeed. I had the (a) reaction when my girlfriend pointed out that two tunes
> I'd known for decades -- "Boll Weevil" as sung by Lead Belly and the most
> common pop version of "Frankie and Johnny" were very close to being the same
> tune.
>
> Peace,
> Paul
> Just a-lookin' for a home,
> But he was doin' her wrong
>
> --
> john garst    [unmask]
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Sameness of tunes
From: Adam Miller <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 09:51:05 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


Dear Readers,Recently, a nine year old girl pointed out that the theme from the1960's tv
show "Gilligan's Island" is, in fact, the same tune as "Days of '49," a song
from the California Gold Rush.  And I think she's quite correct.-Adam Miller

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Apologies to All (Was: Re: Bayard)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 12:54:15 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(50 lines)


Robert B. Waltz wrote:
>
> I've been thinking about what I wrote last night, and want to
> apologise to Bruce Olson and to the list. I spoke much too
> strongly. (I can only confess to having been on the computer
> for most of the past twelve hours before I wrote what I wrote.)
>
> I stand by the statement that "sameness" must be defined
> by what human beings collectively perceive. But I could
> have said it in a quieter tone of voice.
>
> --
> Bob Waltz
> [unmask]
>
> "The one thing we learn from history --
>    is that no one ever learns from history."Thanks Bob, and I apologize too. My doctor put me on a new medicine
11 days ago, and its done wonders for me physically, but mentally I've
been hyperactive, impatient, short tempered, etc,etc,etc. Dosage reduced
yesterday, and I have hopes for a return to (relative) sanity.
[Challenge: define 'sanity". Whose?]My position is that our words of description, if we want to be
reasonably accurate for our purposes here, must be referenced to some
body of data that gives at least an approximate range of validity to
start from. For short lets just call this the context. My position is
that arguments about meanings but without a reasonably known context is
a pointless waste of time for our purposes.I'm going to need that time to unravel how to get at the database
of 1.8 million records at Dissertation Abstracts, seaching on a
keyword that I can understand, in order to find a thesis: [The
keywords that I understand are those that aren't connected to a
data file, and those that do click to a data file don't seem to
include proper names and music as searchable items.]From Ed Cray:Anne Dhu Shapiro [now McLucas], 'The Tune-Family Concept in
British-American Folk-Song Scholarship', Harvard, Music
Department, May, 1975.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Creighton Collection CD
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 10:04:46 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(41 lines)


Folks:I am forwarding this announcement from Clary Croft in Halifax.  While I have not heard the CD, any release of Helen Creighton's archive material is good news.Ed-------------------------------------------------------------------------From     Clary Croft <[unmask]>
Sent    Friday, August 29, 2003 7:38 am
To      Ed Cray <[unmask]>
Cc
Bcc
Subject         Creighton CDThe Helen Creighton Folklore Society is proud to present Songs of the
Sea - the first in a series of field recordings from the Helen Creighton
Collection.  The material on this double CD is a small representation of
the English language sea songs and narratives found in the vast
collection of ?Canada?s First Lady of Folklore?.FOR A SNEAK PREVIEW, LISTEN TO OLGA MILOSEVICH?S RADIO PROGRAM.  SHE
WILL BE FEATURING CUTS FROM BOTH CDS.  CBC RADIO 2, SATURDAY, SEPTEMBER
6TH BETWEEN 11AM AND NOON; AND SUNDAY, SEPTEMBER 7TH ON CBC RADIO 1
BETWEEN 4-5 PM.The CD was officially launched on August 21st at Evergreen House, 26
Newcastle Street, Dartmouth. [Helen?s former home and now the operations
base for the Dartmouth Heritage Museum Society.] The launch was part of
an exhibit on Dr. Creighton?s life and career, currently on display
until September 27.  For more information on the exhibit contact the
museum at 464-2300.Copies of the CD can be purchased at the museum for $25.00.To order additional copies of the CD contact the Helen Creighton
Folklore Society at http://www.CorvusCorax.org:8080/~gseto/creighton/and for additional information concerning the project, contact Clary
Croft at  423-5759 or http://www3.ns.sympatico.ca/cs.croft/

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Apologies to All (Was: Re: Bayard)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 13:24:15 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


edward cray wrote:
>
> Paul:
>
> Woody Guthrie was a great borrower, often unaware he had done so.  Leadbelly's "Goodnight, Irene" furnished the tune for "Roll on, Columbia" -- a fact Guthrie didn't realize until Pete Seeger pointed it out.  ('Course, neither Guthrie nor Ledbetter gave a rat's ass about the "theft.")
>
> EdThat is practically the whole point of the search of a method of
coding tunes by distinguishable characteristics and putting these
distinguishing characteristics in quantative form in a searchable
database where one can search out 'same' and 'variant' tunes (like file
COMBCOD3.TXT on my website, which has only a trivial 6000 or so tunes
plus variants).However, independent reinvention isn't all that uncommon, and we
will still be left with some false derivations, that I doubt we
will ever discover the truth of. [And we can't always know the
earliest date that a particular variant was first used,
(particularly with traditional tunes) and so we can't fully trust
a chronological order as implying the order of sucession of
'variants'.]Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 13:34:14 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(20 lines)


Adam:Good catch!  My kids watched that stupid show interminably, yet I never picked up on the thematic music.  I guess "Days of 49" sounded nautical to the music director.Ed----- Original Message -----
From: Adam Miller <[unmask]>
Date: Friday, August 29, 2003 7:51 am
Subject: Sameness of tunes> Dear Readers,
>
> Recently, a nine year old girl pointed out that the theme from the1960's tv
> show "Gilligan's Island" is, in fact, the same tune as "Days of '49," a song
> from the California Gold Rush.  And I think she's quite correct.
>
> -Adam Miller
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "David G. Engle" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 13:47:16 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(42 lines)


Bill wrote, among other cogent things:...>So I think Bayard and Wilgus and Bronson were asserting a historical
>connection from signer to singer when they spoke of tune families or "the
>same tune."  But the terms are not defined precisely.  Indeed, there is an
>element of speculation in all this:  How can we __prove__ that a certain
>melody derives from another melody if we were not there when that certain
>melody was first sung, to question the singer (or fiddler or
>whistler)?  And so there is probably no way to define the term
>operationally or "scientifically."  It is perfectly conceivable that a
>convergence from two distinct source tunes might produces two tunes that
>are not "the same" in the sense I have just used it, but are measurably
>more alike than are two other tunes that are in fact variants of one and
>the same source tune.I am unsure (although I definitely suspect) of Bayard and Bronson,
but of Wilgus I feel safe in venturing to say that - while the
"historical" connection may be the most common - what was important
to him was the structural affinity, thus definitely recognizing the
possibility of convergence adding a tune to a family.  I would submit
it works as well - or better! - for melody as it does for text.Of course that does not solve Bruce's and Bob's problem: how could
one develop relatively objective criteria for "familiarity" (to avoid
the "samness") and still make sense to the ear.  Strange bedfellows,
objectivity and orality!--David G. Engleemail:  [unmask]
web:    http://www.csufresno.edu/folklore
        http://www.csufresno.edu/forlang         The Traditional Ballad Index:
         http://www.csufresno.edu/folklore/BalladIndexTOC.html---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: J M F <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 16:55:52 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


>  From [unmask] Fri Aug 29 06:21:09 2003
>  Date: Fri, 29 Aug 2003 10:55:58 +0100
>  From: Jack Campin <[unmask]>
>  Subject: Re: Bayard
>  Comments: To: Forum for ballad scholars <[unmask]>
>  To: [unmask]>  I spent most of my life thinking that "The Minstrel Boy" and "The
>  Girl I Left Behind Me" were the same tune.  I first heard both at
>  around the same time, on the radio when I was about six, and somehow
>  never got round to separating them in my mind.  Apart from metre
>  they don't have a lot in common.  The explanation of the perceived
>  identity here has to be from my psychology and personal history, not
>  from any formal similarity.Actually, "The Minstrel Boy To War Has Gone" & "Forgive Me If All Those
Endearing Young Charms" are very similar.  Dunno "Girl I Left Behind Me".

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes/ different attitude
From: Truman and Suzanne Price <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 14:16:47 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(25 lines)


> It is my observation, I think, that people will often not recognize
> similarities between tunes until they are pointed out.  Then they
> will have one of two reactions: (a) "That's amazing!  I never
> realized it before."  (b) "No!  These tunes are different.">There are two DIFFERENT concepts of sameness involved here.  You're
>talking about perceived sameness, which is a pretty tough one to
>provide theoretical explanations for.   I used to occasionally play the tune from "Shule Aroo  / Johnny Has Gone
For a Soldier".   I used the same melody as the tune "When Johnny Comes
Marching Home again, and thought of it as a sweet sad lament expresed by an
abandoned girl whose lover has gone off to the wars.
  Then I noticed a John Wayne movie in which the background theme was "When
Johnny Comes Marching Home Again":  powerful, strident, blusterous.  The
notes used were exactly those I'd played for Shule Aroo.  Later I used it as
demonstration for students, playing the same notes two ways, first thinking
one thing, then thinking the other.  It sounded very like two different
pieces, but the notes were precisely the same: the intent was different.  Comment?--
Truman Price
Monmouth, OR 97361

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 17:05:51 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(56 lines)


On 8/29/03, David G. Engle wrote:>Bill wrote, among other cogent things:
>
>...
>
>>So I think Bayard and Wilgus and Bronson were asserting a historical
>>connection from signer to singer when they spoke of tune families or "the
>>same tune."  But the terms are not defined precisely.  Indeed, there is an
>>element of speculation in all this:  How can we __prove__ that a certain
>>melody derives from another melody if we were not there when that certain
>>melody was first sung, to question the singer (or fiddler or
>>whistler)?  And so there is probably no way to define the term
>>operationally or "scientifically."  It is perfectly conceivable that a
>>convergence from two distinct source tunes might produces two tunes that
>>are not "the same" in the sense I have just used it, but are measurably
>>more alike than are two other tunes that are in fact variants of one and
>>the same source tune.
>
>I am unsure (although I definitely suspect) of Bayard and Bronson,
>but of Wilgus I feel safe in venturing to say that - while the
>"historical" connection may be the most common - what was important
>to him was the structural affinity, thus definitely recognizing the
>possibility of convergence adding a tune to a family.  I would submit
>it works as well - or better! - for melody as it does for text.
>
>Of course that does not solve Bruce's and Bob's problem: how could
>one develop relatively objective criteria for "familiarity" (to avoid
>the "samness") and still make sense to the ear.  Strange bedfellows,
>objectivity and orality!Just as a footnote here, there IS a way to prove ancestry in the
genetic sense: Analysis of variants into a stemma (chart of
ancestry), which can be made rigorous through the use of a
mathematical tool known as chladistics. This has been done for
manuscripts (of Chaucer, and I know a guy who is applying it
to the New Testament). I hope later this year to offer a paper
showing some of the relevant techniques (only some because I
don't know them all). To date, the material has been applied
only to texts and genetic sequences, but there is no reason it
shouldn't be applied to tunes.Chladistics is a method of finding the archetype of a group
of relatives. It also tells how things got from point A to
point B. But it won't tell us which versions are the same --
in fact, strange as it will sound, things closely related often
seem by their appearances to be quite distinct.Yet another reason why I worry about this topic....--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: journal publication question
From: Beth Brooks <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 17:23:00 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(8 lines)


Oh wise ones:
   Please come to my aid once again. I have completed my research paper on the history and variants of "Pretty Polly"  (and thank you all for your insight into filling in the gaps).  It's fairly substantial and the research is thorough and legitimate.
  The question is, to which publication should I submit it? It's got a lot of musical information on meter, tonality, rhythm, key, etc., but it's also got a lot of text information in a folklore vein, as well as collection information and geographical and historical considerations.
   Journal of American Folklore? British Journal of Ethnomusicology? Southern Folklore Quarterly? Something I haven't heard of?
   Any suggestions would be greatly appreciated. I've not gone through the process before.Beth Brooks
Indiana University

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 20:06:34 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


J M F wrote:
>
> >
> >  I spent most of my life thinking that "The Minstrel Boy" and "The
> >  Girl I Left Behind Me" were the same tune.  I first heard both at
> >  around the same time, on the radio when I was about six, and somehow
> >  never got round to separating them in my mind.  Apart from metre
> >  they don't have a lot in common.  The explanation of the perceived
> >  identity here has to be from my psychology and personal history, not
> >  from any formal similarity.
>For "Minstrel Boy" tune apparent origin, a MS of 1787, see Moreen2
in the Irish tune titles on my website. And, there, "My lodging is on
the cold ground" for "Endearing young charms" Moreen1 is an older bawdy
song found in my Scarce Songs 2 file.Most of commentary on "The girl I left behind me" in Wm.
Chappell's PMOT seems to be purely from his imagination as far as
the 18th century goes. See EASMES for very late 18th century
copies of the tune. A song of 1799 to the tune was "The Girls
we love so dearly".Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Bayard
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 22:20:32 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(51 lines)


> J M F wrote:
> >
> > >  I spent most of my life thinking that "The Minstrel Boy" and "The
> > >  Girl I Left Behind Me" were the same tune.  I first heard both at
> > >  around the same time, on the radio when I was about six, and somehow
> > >  never got round to separating them in my mind.  Apart from metre
> > >  they don't have a lot in common.  The explanation of the perceived
> > >  identity here has to be from my psychology and personal history, not
> > >  from any formal similarity.Tunes for "Minstrel Boy" and "Believe me..endearing young charms"
are similar but not variants. "Girl I left behind me" is quite
different. These results come from plotting stressed note codes
(as you can do on your computer screen) already available in:File COMBCOD3.TXT on my website,with cross reference#5340 are 4 variants of the tune for "The Minstrel Boy"
2048 "   4    " .   .   .           "Endearing youg charms"
5244 "   7    " ...................."Girl I left behind me"With Program CODEDSP9.EXE on my website you can graphically
display the stressed note codes of any 12 of these
simultaneously on your computer scren.Steps to find them:
1: Find one title from word search (a word, phrase, or fragment
that you know, any place in the tune title) in Option 5, 1 (= search in
title)
2: find cross ref# from display.
3: With cross ref# entered in Option 3 you will find all variants
of the tune regardless of title
4: Save all found (with one click) into the display fileClick 0 twice to plot first 12 stressed note codes on you computer
screen, else: Pick the 12 you want to display using the editing option
to delete items or rearrange them in the display file. You can go back
and forth between editing and display as you like.['Sames' tunes are listed in the index files, but would it be a
useless repeat of much data that just wastes space in the
stressed note code file, so are not included there.]Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: journal publication question
From: "Steiner, Margaret" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 21:31:47 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


You could try any of those--also Ethnomusicology and the yearly journal published by the English Folk Dance and Song Society.        Marge-----Original Message-----
From: Beth Brooks [mailto:[unmask]]
Sent: Friday, August 29, 2003 5:23 PM
To: [unmask]
Subject: journal publication questionOh wise ones:
   Please come to my aid once again. I have completed my research paper on the history and variants of "Pretty Polly"  (and thank you all for your insight into filling in the gaps).  It's fairly substantial and the research is thorough and legitimate.
  The question is, to which publication should I submit it? It's got a lot of musical information on meter, tonality, rhythm, key, etc., but it's also got a lot of text information in a folklore vein, as well as collection information and geographical and historical considerations.
   Journal of American Folklore? British Journal of Ethnomusicology? Southern Folklore Quarterly? Something I haven't heard of?
   Any suggestions would be greatly appreciated. I've not gone through the process before.Beth Brooks
Indiana University

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes/ different attitude
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 29 Aug 2003 20:32:40 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(37 lines)


Folks:I would suggest -- as others have posited in the last two days -- that your did not have on your analytical cap, but was instead wearing your emotive toupe.Ed----- Original Message -----
From: Truman and Suzanne Price <[unmask]>
Date: Friday, August 29, 2003 2:16 pm
Subject: Re: Sameness of tunes/ different attitude> > It is my observation, I think, that people will often not recognize
> > similarities between tunes until they are pointed out.  Then they
> > will have one of two reactions: (a) "That's amazing!  I never
> > realized it before."  (b) "No!  These tunes are different."
>
> >There are two DIFFERENT concepts of sameness involved here.  You're
> >talking about perceived sameness, which is a pretty tough one to
> >provide theoretical explanations for.
>
>   I used to occasionally play the tune from "Shule Aroo  / Johnny Has Gone
> For a Soldier".   I used the same melody as the tune "When Johnny Comes
> Marching Home again, and thought of it as a sweet sad lament expresed by an
> abandoned girl whose lover has gone off to the wars.
>  Then I noticed a John Wayne movie in which the background theme was "When
> Johnny Comes Marching Home Again":  powerful, strident, blusterous.  The
> notes used were exactly those I'd played for Shule Aroo.  Later I used it as
> demonstration for students, playing the same notes two ways, first thinking
> one thing, then thinking the other.  It sounded very like two different
> pieces, but the notes were precisely the same: the intent was different.
>
>  Comment?
>
> --
> Truman Price
> Monmouth, OR 97361
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes/ different attitude
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 02:05:45 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


edward cray wrote:
>
> Folks:
>
> I would suggest -- as others have posited in the last two days -- that your did not have on your analytical cap, but was instead wearing your emotive toupe.
>
> Ed
>Stressed note coding of tunes the way I do it is time consuming
enough, already. No new 'emotive' index unless you do it yourself.Songs: Ed hasn't even made a 'horniness' index of the songs in
his 'The Erotic' Muse'.Tunes: For an 'ungodliness' index hymn tunes all get a 0, but
Ed's tunes all get a 10. [The devils tunes are best, so we
have to use 'ungodliness' rather than 'godliness' to get the
index to point us in the right direction.]Now, back to the so far futile search for Anne Shapiro's 'tune-family'
thesis. She's only 3000 miles away, and I still remember a little about
the campus, so I may just drive out and ask her if I can make a xerox
copy her copy.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 01:29:34 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


<<Good catch!  My kids watched that stupid show interminably, yet I never
picked up on the thematic music.  I guess "Days of 49" sounded nautical to
the music director.>>I've always identified "Days of 49" as being part of the "Star of the County
Down" family, which does include a lot of nautical songs as well.Peace,
PaulEd----- Original Message -----
From: Adam Miller <[unmask]>
Date: Friday, August 29, 2003 7:51 am
Subject: Sameness of tunes> Dear Readers,
>
> Recently, a nine year old girl pointed out that the theme from the1960's
tv
> show "Gilligan's Island" is, in fact, the same tune as "Days of '49," a
song
> from the California Gold Rush.  And I think she's quite correct.
>
> -Adam Miller
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Treasury of Field Recordings
From: Andrew Brown <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 04:17:34 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


I discussed the recent thread on the "Treasury of Field
Recordings" (77 Records) with Mack McCormick last night. He
dismisses the "99 copies" claim as a fantasy, stating that
everyone invovled received at least one copy (that would have been
about 30-40 people), and moreover, he received royalties on copies
sold from Dobell for many years -- throughout the sixties if not
the 1970s. He estimates that actually 2-4 thousand were sold over
a period of time.He wanted to know if Dobell was still living. That didn't come up
during the thread, I don't think.He claims the Joel & Lightning Hopkins album on Heritage (1001)
was in fact a limited edition of 99 copies.--Andrew________________________________________________________________
Sent via the EV1 webmail system at mail.ev1.net

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 05:53:23 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(23 lines)


Paul Stamler wrote:
>
> <<Good catch!  My kids watched that stupid show interminably, yet I never
> picked up on the thematic music.  I guess "Days of 49" sounded nautical to
> the music director.>>
>
> I've always identified "Days of 49" as being part of the "Star of the County
> Down" family, which does include a lot of nautical songs as well.
>
> Peace,
> Paul
>That Scots tune, "Gilderoy" was around for over a century and a half
before there was a "Star of the County Down" song to give it its new
Irish name.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Treasury of Field Recordings
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 08:00:15 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(45 lines)


A few comments:1.] I can't speak for Mr. McCormick's memory but, as cited in one of my
postings, during 1959 he referred to these recordings which appeared on
"Doug Dobell's limited-edition '77' label." That he recalls "everyone
involved received at least one copy" fits with with some of the comments
made by Brian Harvey in another article I cited in the thread.
Worth noting as well. I read the sellers description of the two discs
when they were listed on E-Bay. In that description mention was made of
a red hand stamped number [36 I believe] on the rear cover. This
corresponds with Les' memory of each copy being numbered.2.] As for royalties and sales of 2-4 thousand. Is it possible that
Dobell arranged the licensing for the American issue on Candid [at least
of volume one] and, in turn, reported these sales to Mr. McCormick?3.] Doug Dobell is deceased.Andrew Brown wrote:>I discussed the recent thread on the "Treasury of Field
>Recordings" (77 Records) with Mack McCormick last night. He
>dismisses the "99 copies" claim as a fantasy, stating that
>everyone involved received at least one copy (that would have been
>about 30-40 people), and moreover, he received royalties on copies
>sold from Dobell for many years -- throughout the sixties if not
>the 1970s. He estimates that actually 2-4 thousand were sold over
>a period of time.
>
>He wanted to know if Dobell was still living. That didn't come up
>during the thread, I don't think.
>
>He claims the Joel & Lightning Hopkins album on Heritage (1001)
>was in fact a limited edition of 99 copies.
>
>--Andrew
>
>
>
>
>________________________________________________________________
>Sent via the EV1 webmail system at mail.ev1.net
>
>
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Treasury of Field Recordings
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 09:45:04 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(71 lines) , text/html(59 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Treasury of Field Recordings
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 10:46:48 -0500
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(94 lines) , text/html(102 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Shapiro's tune-family thesis
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 12:27:21 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


Start:Anne Dhu Shapiro, 'The Tune-Family Concept in British-American
Folk-Song Scholarship', Harvard, Music Department, May, 1975.Slightly extended background, but probably not progress.
DDM-online (Univ. of Indiana) cites it thus:Anne Rondeau Shapiro, 'The Tune-Family Concept in
British-American Folk-Song Scholarship', Harvard, Music
Department, May, 1975. 2 vols; 394 pages.
DDM Code 02etShaA   DA no.   RILM no. 76:11931ddLittle of this is useful at wwwlib.umi.com/dissertations/search,
where one should be able to purchase a copy of the thesis. For
search you specify author and date range for degree. But it
ignores your date range, and only searches 2002 and 2003. I
think the $25 they want to do the search for you may be the only
way, and if your time is worth as much as $25 per hour it begins
to look like a bargain.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 11:39:18 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


----- Original Message -----
From: Bruce Olson <[unmask]><<That Scots tune, "Gilderoy" was around for over a century and a half
before there was a "Star of the County Down" song to give it its new
Irish name.>>I used the name by which it's most commonly known to fiddlers, at least
American fiddlers.Peace,
Paul

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 13:49:01 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(23 lines)


Paul Stamler wrote:
>
> ----- Original Message -----
> From: Bruce Olson <[unmask]>
>
> <<That Scots tune, "Gilderoy" was around for over a century and a half
> before there was a "Star of the County Down" song to give it its new
> Irish name.>>
>
> I used the name by which it's most commonly known to fiddlers, at least
> American fiddlers.
>
> Peace,
> PaulGood advice I've found is, when in Rome do as the Romans do.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 14:34:35 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(17 lines) , text/html(12 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 14:37:45 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(18 lines) , text/html(16 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Ebay List - 08/30/03
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 14:29:11 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(108 lines)


Hi!        Here I am again - with more items for your bidding (and
discussion)!        SONGSTERS        2553928999 - The Gipsy Songster, 1844, $10.50 (ends Sep-02-03
14:07:38 PDT)        3623812335 - JOHN FOSTER'S NEW YORK GREAT CIRCUS SONGSTER, $9.99
(ends Sep-03-03 10:20:42 PDT)        SONGBOOKS, ETC.        2553162272 - Early Spanish-Californian Folk-Songs by Hague,
1922, $9.99 (ends Aug-31-03 10:00:00 PDT)        3546672328 - Smiling Jim Waters - Singing Cowboy Song Folio,
1940, $5 (ends Aug-31-03 12:39:03 PDT)        3546722803 - Folk Songs of the Blue Ridge Mountains by Shellans,
1968, $7.99 (ends Aug-31-03 16:12:54 PDT)        3547189725 - Steamboatin Days Folk Songs of the River Packet Era
by Wheeler, 1944, $9.99 (ends Aug-31-03 19:27:39 PDT)        3546780452 - A HANDFUL OF PLEASANT DELIGHTS, 1924, $22 (ends
Aug-31-03 20:31:11 PDT)        3546880469 - Ballads From The Streets and Jails of Ireland by
Shannon, 1966, $11.50 (ends Sep-01-03 11:11:57 PDT)        3546885390 - A Book of Shanties by Smith, 1927, 10.50 GBP (ends
Sep-01-03 11:29:22 PDT)        3546844916 - Sea Songs and Shanties by Whall, 1948 edition,
$17.95 (ends Sep-01-03 18:00:00 PDT)        2553773826 - Reliques of Ancient English Poetry by Percy, 1887
printing, 3 volumes, $38 (ends Sep-01-03 18:55:38 PDT)        3547124332 - Folk Legacies Revisited by Cohen, 1995, $4.99 (ends
Sep-02-03 13:43:39 PDT)        3547194727 - American Negro Folk Songs by White, 1928, $5 (ends
Sep-02-03 19:50:15 PDT)        3547245080 - THE BROADSIDE BALLAD. The Development of the Street
Ballad From Traditional Song to Popular Newspaper by Shepard, 1962,
$9.99 (ends Sep-03-03 06:15:23 PDT)        3345138287 - Bradley Kincaid's Collection Mountain Ballads,
1939, $3 (ends Sep-03-03 16:00:43 PDT)        3546807935 - EIGHTY ENGLISH FOLK SONGS by Sharp & Karpeles, 1975
edition, 8.50 GBP (ends Sep-04-03 02:11:20 PDT)        2554488122 - Songs Under Sail by Heaton, 1963, 8.50 GBP (ends
Sep-04-03 12:32:38 PDT)        3547689783 - Popular Music of the Olden Time by Chappell, 2
volumes, 1965 Dover reprint, $4 (ends Sep-04-03 15:04:53 PDT)        3547713493 - Scottish Ballads by Lyle, 1995, $4.99 (ends
Sep-04-03 16:45:08 PDT)        2554625101 - Simmons Family Songbook, 1976 printing, $4.95 (ends
Sep-04-03 17:54:21 PDT)        3547754851 - Journal of American Folklore, winter, 1995, $2.50
(ends Sep-04-03 20:22:07 PDT)        3547756276 - The Ballad And The Plough by Cameron, $7.99 (ends
Sep-04-03 20:30:42 PDT)        3547756913 - British Ballads From Maine by Barry, Eckstrom &
Smyth, 1929, $19 (ends Sep-04-03 20:35:06 PDT)        3547855989 - Book of British Ballads by How, 2 volumes,
1842-1844, 1.76 w/reserve (ends Sep-05-03 11:50:11 PDT)        3547574187 - Jacobite songs and ballads by Scott?, 1887 edition,
$10.75 w/reserve (ends Sep-07-03 10:37:36 PDT)        3547605043 - Ballads From The Pubs Of Ireland by Healey, vol. 1,
1996 edition, 3 GBP (ends Sep-07-03 11:45:50 PDT)        3547634691 - Folk Song in England by Lloyd, 1975 edition, 1.50
GBP (ends Sep-07-03 12:46:42 PDT)        3547679886 - HOLROYD'S COLLECTION of YORKSHIRE BALLADS, 1892,
$20 (ends Sep-07-03 14:34:33 PDT)        MISCELLANEOUS        2553572141 - YONDER GO THAT OLD BLACK DOG/BLUES,SPRITUALS AND
FOLKSONGS FROM RURAL GEORGIA by Jones & family, 1974 Testament LP, $2.99
(ends Aug-31-03 19:03:48 PDT)                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 14:52:00 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


Anne Dhu McLucas (nee Shapiro) says she alone can provide a copy of her
thesis, and will do so for me for costs of duplication, and postage.
Her offer has been accepted.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 15:38:43 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(49 lines)


[unmask] wrote:
>
> In a message dated 8/30/2003 10:52:34 AM GMT Daylight Time,
> [unmask] writes:
>
>      That Scots tune, "Gilderoy" was around for over a century
>      and a half
>      before there was a "Star of the County Down" song to give it
>      its new
>      Irish name.
>
> The Star of the County Down is very recent - it was written by a man
> from Ramelton in Donegal who spent most of his life in Dublin and died
> in 1927. Named Cathal McGarvey he is also credited with "The Devil and
> Bailiff McGlynn." Before that, in Ireland, the tune was generally
> called "My love Nell." and of course, in England, "Dives and Lazarus."
>
> John MouldenThanks John,In 'The Blarney Comic Song Book' Glasgow, Cameron & Ferguson, n.
d. (c 1865?) "My Love Nell" is attributed to William Carleton, and
has tune direction "Come all ye" (for which I have no
identification). Carleton was writing and singing songs in Tony
Pastor's Opera Salon in New York City in the first half of the
1860s, and the song may well be Irish/American (like his
"Lannigan's Wake" imitation of "Finigins' Wake" to Tony Pastor's
tune "Lannigan's Ball"). [The Levy sheet music website contains
other songs by him, and such as John F. Poole (Finigins' Wake),
and Tony Pastor, but rarely any of their best known songs.]In 'Sources of Irish Traditional Music" and the complete Petrie
collection, taking us through 1864, we can't find "'Gilderoy" in
any Irish source through that date.Paul, sorry, but I take Ballad-L to be a forum for informed
intelligent discussion of all English language songs and tunes.
It has taken a long time to get some real experts on Scots songs
and music here, but we've got them now, and let's not drive them
away with narrow ethnocentric based names and terminology that
they may not understand. This isn't an American fiddlers forum.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 15:58:23 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


Bruce Olson wrote:> Her offer has been accepted.With considerably more grace than I managed here.Bruce Olson

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay List - 08/30/03
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 15:14:23 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(20 lines)


On 8/30/03, Dolores Nichols wrote:[ ... ]>        3547194727 - American Negro Folk Songs by White, 1928, $5 (ends
>Sep-02-03 19:50:15 PDT)>        3547689783 - Popular Music of the Olden Time by Chappell, 2
>volumes, 1965 Dover reprint, $4 (ends Sep-04-03 15:04:53 PDT)I'm mildly interested in these two (the first more than the second),
but I'm not going to go very high. Anyone else want to fight over
them? Because I'll yield.--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Tune Families
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 18:01:49 EDT
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


It's too bad that Sam Bayard is not still with us so he could elucidate what
he meant by describing two tunes as "the same."  He certainly did not mean
that every tone and interval must be the same, and in the precisely the same
sequence, as those of another tune in order for them to be "the same."Sameness might be defined as similar finger-patterns of playing--especially
on the diatonic or cross-strung harp, where a simple shifting of the hands one
string toward the player can change a tune from Ionian to Dorian, or from
Dorian to Phrygian. On the penny whistle,  an Ionian tune in the key of the
instrument has its tonic sounded when all six fingers are covering the holes; if the
right middle finger be lifted from hole No. 6 or 1 (depending upon the
orientation used) and the resulting sound taken as the tonic, the same pattern of
fingering will give you the tune in the Dorian mode.  Or on the non-folk piano
keyboard, a tune played entirely on the white keys with C as its tonic will be
changed from Ionian to Dorian if D is used as the tonic, and still no black
keys are used.    Bertrand Bronson diagrammed an interesting "mode star"  on
page xii of Volume 2 of his _Traditional Tunes of the Child Ballads_,  which
shows how easily a performer could drop one of the tones (the 7th, for example)
from the scale of a song, and how a subsequent singer might restore the "gap" by
filling in the missing tone, but perhaps lowering it a half-step, thus,
continuing the example, changing the "original" tune from Ionian to Mixolydian.I think anyone who knows a lot of songs will have often had the experience of
hearing a tune that "reminds" him of another tune, without being able to
articulate the similarities. Such reminding might not be the same for every
singer, and this poses another problem for the Bayards among us (if indeed there are
any!) to solve.I believe that some of us might profit from almost any cogent discussion of
the "families" of tunes, while others may not perceive tune relationships or
think them of any importance.  That's as it should be!Sam Hinton
La Jolla, CA

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Apologies to All (Was: Re: Bayard)
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 18:19:12 EDT
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


In a message dated 08/29/03 9:17:23 AM, Ed Cray ( [unmask]  )writes:>Woody Guthrie was a great borrower, often unaware he had done so.
Leadbelly's
>"Goodnight, Irene" furnished the tune for "Roll on, Columbia" -- a fact
>Guthrie didn't realize until Pete Seeger pointed it out.  ('Course, neither
>Guthrie nor Ledbetter gave a rat's ass about the "theft.")
***********************************************
Some of Woody's "borrowings"  bear an aura of artistic improvement. "Pastures
of Plenty"  is pretty much the same tune as "Pretty Polly,"  but its
repeating of one musical phrase  makes  it, to my ear, a much "better"  piece of music.Sam Hinton
La Jolla, CA

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 15:19:25 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(40 lines)


Bruce:The problem may be that the index has the name wrong.  It is NOT Anne Rondeau... on the title page, but Anne Dhu...Ed----- Original Message -----
From: Bruce Olson <[unmask]>
Date: Saturday, August 30, 2003 9:27 am
Subject: Shapiro's tune-family thesis> Start:
>
> Anne Dhu Shapiro, 'The Tune-Family Concept in British-American
> Folk-Song Scholarship', Harvard, Music Department, May, 1975.
>
> Slightly extended background, but probably not progress.
> DDM-online (Univ. of Indiana) cites it thus:
>
> Anne Rondeau Shapiro, 'The Tune-Family Concept in
> British-American Folk-Song Scholarship', Harvard, Music
> Department, May, 1975. 2 vols; 394 pages.
> DDM Code 02etShaA   DA no.   RILM no. 76:11931dd
>
> Little of this is useful at wwwlib.umi.com/dissertations/search,
> where one should be able to purchase a copy of the thesis. For
> search you specify author and date range for degree. But it
> ignores your date range, and only searches 2002 and 2003. I
> think the $25 they want to do the search for you may be the only
> way, and if your time is worth as much as $25 per hour it begins
> to look like a bargain.
>
> Bruce Olson
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> http://www.erols.com/olsonw"> Click here for homepage (=
> subject index)
>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tune Families
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 19:36:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(63 lines)


[unmask] wrote:
>
> It's too bad that Sam Bayard is not still with us so he could elucidate what
> he meant by describing two tunes as "the same."  He certainly did not mean
> that every tone and interval must be the same, and in the precisely the same
> sequence, as those of another tune in order for them to be "the same."
>
> Sameness might be defined as similar finger-patterns of playing--especially
> on the diatonic or cross-strung harp, where a simple shifting of the hands one
> string toward the player can change a tune from Ionian to Dorian, or from
> Dorian to Phrygian. On the penny whistle,  an Ionian tune in the key of the
> instrument has its tonic sounded when all six fingers are covering the holes; if the
> right middle finger be lifted from hole No. 6 or 1 (depending upon the
> orientation used) and the resulting sound taken as the tonic, the same pattern of
> fingering will give you the tune in the Dorian mode.  Or on the non-folk piano
> keyboard, a tune played entirely on the white keys with C as its tonic will be
> changed from Ionian to Dorian if D is used as the tonic, and still no black
> keys are used.    Bertrand Bronson diagrammed an interesting "mode star"  on
> page xii of Volume 2 of his _Traditional Tunes of the Child Ballads_,  which
> shows how easily a performer could drop one of the tones (the 7th, for example)
> from the scale of a song, and how a subsequent singer might restore the "gap" by
> filling in the missing tone, but perhaps lowering it a half-step, thus,
> continuing the example, changing the "original" tune from Ionian to Mixolydian.
>
> I think anyone who knows a lot of songs will have often had the experience of
> hearing a tune that "reminds" him of another tune, without being able to
> articulate the similarities. Such reminding might not be the same for every
> singer, and this poses another problem for the Bayards among us (if indeed there are
> any!) to solve.
>
> I believe that some of us might profit from almost any cogent discussion of
> the "families" of tunes, while others may not perceive tune relationships or
> think them of any importance.  That's as it should be!
>
> Sam Hinton
> La Jolla, CAI have ask Anne Dhu McLucas for permission to repost here an email she
sent me earlier today, but haven't yet gotten a reply, and she's
hurrying to get ready to go to a meeting in Wales, and might not have
time to reply for a while. Hence this preliminary account, for whose
inaccuracies I am solely responsible.Her email revealed quite a bit about how Bayard worked, as she worked
with him for a short time. His methodology, and much of his database was
entirely within his head.Further, Anne Dhu McLucas has not been idle, and her proposed book, 'A
Thesaurus of Tune Families' is in progress. Her database is 10,000 whole
folk tunes, (I don't know what format for musical notation)
premininarily sorted by stressed notes, and analyzed by reference to 12
tune characteristics. She programs in C (or her students did it for her,
I don't know which, but her efforts haven't been entirely solo).She has given up the job of Dean of the School of Music, and hopes to be
thus able to devote more time to her research.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 19:41:56 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


edward cray wrote:
>
> Bruce:
>
> The problem may be that the index has the name wrong.  It is NOT Anne Rondeau... on the title page, but Anne Dhu...
>
> EdI suspected as much, and should have indicated that I didn't mistrust
you, who actually had part of the thesis. Sorry.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: tune families & comparisons (long)
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 01:31:16 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(209 lines)


I posted this to the ABC list a while back, as a challenge for anyone's
algorithmic methods of tune comparison.X:1
T:Mary Scott
S:Agnes Hume's music book, 1704, Adv.MS.5.2.17
Z:Jack Campin 1998-2000
N:for some sort of lute
N:original written on a six-line staff!
M:6/4
L:1/4
K:Amix
DEG "="A2[Bd]|"="A2[Bd] "="[F3/2A3/2]E/D|\
EFA "="[B2d2][Ac]|"="[B2d2]A "="[B2d2]A|
DEG "="A2[Bd]|"="A2[Bd] "="[F3/2A3/2]E/D|GA/G/F/E/ FG/F/E/D/|EFA "="[B2d2]A||
"="[d3D3] "="d>cB|ABd "="[F3/2A3/2]E/D|"="[e3E3] "="e>de|"="fe"="d "="e>dc|
"="[d3D3] "="d>cB|ABd "="[F3/2A3/2]E/D|GA/G/F/E/ FG/F/E/D/|EFA "="[B2d2]A|]X:2
T:When ye Cold winter nights were frozen or The Banks of Yaro
S:Thomson MS (1702), David Johnson's edition
Z:Jack Campin 1998-2000
N:for treble recorder
M:6/4
L:1/4
K:GMix
c>de  g2   e |gac' e2c |d e   f    a2    g     |a2       g      a2c'|
c>de  g2   e |gac' e>dc|f g/f/e/d/ e f/e/d/c/  |d  e     g      a2g||
c'2c' c'>d'e'|gac' e2c |d d'  d'   d'2   c'/d'/|e' f'/e'/d'/c'/ a2g |
c'2c' c'>d'e'|gac' e2c |f g/f/e/d/ e f/e/d/c/  |d  e     g      a2g|]X:3
T:untitled
S:Cuming MS, 1723
Z:Jack Campin 1998-2000
N:for the fiddle
M:3/4
L:1/8
K:Ador
D3EFG|A4F2|A2.B2.d2|"="F3ED2|E2.F2.A2|B4(de)|f2(gf)"="e>d|"="B4A2|
D3EFG|"="A4F2|A2.B2.d2|"="F3ED2|G2(AG)"="F>E|F2(GF)"="E>D|E2.F2.A2|"="B4A2||
d2D2d2|d3efe|d2A2Bd|"="F3ED2|e2E2de|"="e4de|f2(gf)"="e>d|"="B3ABc|
d2D2d2|d3efe|d2A2Bd|"="F3ED2|f2(gf)"="e>d|B2(dB)"="A>G|E2.F2.A2|"="B4A2|]X:4
T:Sir John Fenwick's The Flower Amang Them All
S:Northumbrian Pipers' Tune Book volume 1
Z:Jack Campin 1998-2000
M:3/4
L:1/8
K:Amix
D3E FG|A2B2d2|A2B2d2|BA GFED|E3F  GA|B2 B2d2|B2B2d2|MB4 A2 |
D3E FG|A2B2d2|A2B2d2|BA GFED|G2 AGFE|F2 GFED|E2F2A2|MB4 A2||
d2D2F2|d2D2F2|d2D2d2|BA GFED|e2 E2G2|e2 E2G2|e2E2e2|MB4 A2 |
d2D2F2|d2D2F2|d2D2d2|BA GFED|G2 AGFE|F2 GFED|E2F2A2|MB4 A2|]X:5
T:Carraig's Rant
S:NLS MS.21744, tunebook of John McKillop, fifer in the 42nd, 1813
Z:Jack Campin 1998-2000
M:4/4
L:1/8
K:D
D3 F A/A/A AB|ABdA F/F/F FD|EFEF     B/B/B Bf|gfed  B2      A/B/d  |
D3 F A/A/A AB|ABdA F2    ED|GBGB     FAFA    |EFGA TB2     (A/B/d):|
dedf d/d/d dA|BAdA F/F/F FD|e>fef    e/e/e ef|gfed  B/B/B (TBA)    |
d3 f d/d/d dA|BAdA F/F/F FD|G/G/G GB F/F/F FA|EFGA TB2     (A/B/d):|X:6
T:The Smith's a Gallant Fireman
S:the way people round Edinburgh play it in sessions
Z:Jack Campin 1998-2000
M:4/4
L:1/8
R:strathspey
K:D
% D major/mixolydian hexatonic
D2 D>F A<AA>F|A>Bd>A F2E>D|E2 E>G B<BB>A|d>fe>d B2B<d|
D2 D>F A<AA>F|A>Bd>A F2E>D|G>BG<B F>AF<A|E>FG>A B2A2||
d>ef>e d<dd>A|B>Ad>A F2E>D|e2 e>f e2 e>f|g>fe>d B2A2 |
d>ef>e d2 d>A|B>Ad>A F2E>D|G>BG<B F>AF<A|E>FG>A B2A2|]I got the following reply from Phil Taylor:>> Here's a set of tunes that for a dead cert are genetically related.
>> Do any of the tune-matching algorithms suggested here detect that?
>
>I converted each of them to a list of intervals, and assigned each
>interval to a single character IUB protein code.  Since there are
>only 20 of these, I assigned any intervals outside the range
>+-9 semitones to a single catchall code.
>
>I then performed a multiple alignment on these "proteins" using
>the Clustal algorithm.  This tries to find the optimal arrangement
>of the sequences so that you can see areas of similarity where
>the symbols line up.  The results are probably far from optimal,
>and a better choice of symbol for each interval would certainly
>improve things, but nonetheless interesting:
>
>                          10        20        30        40        50
>                           |         |         |         |         |
>                                                           | ||*
>Mary Scott        LVLLILTIILLVLILIL---------IDLVLLILT------IIRLI------
>When Cold         LL-VKV----LVNE------LLSQI---LILVYLLVKVLVNIIRLI------
>Untitled          LLSLKV----LVNIILLVLVLLSGI---IKIDLLSLKVLVNIIRLI------
>Sir John Fenwick  LLSLLVTLVKIIGIILLSLLAVKAVKIDLLSLLVTLVKIIGIIRLI------
>Carraig's Rant    QVAAALILVTKAAAELLILRAAACSGIIKILVYQVAAALILVTKIIRQEQTV
>Fireman           AQVAAKVLVTK----IILAVQAAIRQIIKA-VYAQVAAKVLVTKIIRQEQTV
>
>                        60        70        80        90       100
>                         |         |         |         |         |
>                     ** |* | |*
>Mary Scott        -GILSGIILLVLIRAGII-----LVNIIYAILLII-LIGS------AGIILV
>When Cold         -GILSGIILLVLIRA-ALL---PLVNELY--AAIL-LSGII--KIRAALLPL
>Untitled          -GILSGIILLVLIRYYALL-IITLVNIIYYYLAIL-LSGII--KILSLYYAL
>Sir John Fenwick  -GILSGIILLVLIRYQHYQHYYKIIGIIYYVFYVF-YYTIRYQHYQHYYKII
>Carraig's Rant    KVTLSLLILVALIQEAAATLIRTKAAAEYLILIAAALSGIIKAAAIRQEAAA
>Fireman           KVTLSLLIRLLII---AATLIRTK-----IIYALIALSGIIK---IRLLIIA
>
>                     110       120
>                       |         |
>                                       |  *|*|
>Mary Scott        NIIRLIGILSG----------IILLVLI
>When Cold         VNERLIGILSG----------IILLVLI
>Untitled          LIITLVNIIYSGIIK----VKIIKLVLI
>Sir John Fenwick  GIIRLIGILSG----------IILLVLI
>Carraig's Rant    TLIRTKAAAERAAAQTAAAVTLSLLILV
>Fireman           TLIRTKIIRQEQTVK----VTLSLLI
>
>
>Also interesting is the multiple alignment log.  Clustal starts
>by performing a pairwise alignment for every possible pair of
>sequences, and it gives you a score for each.  For proteins,
>you expect a score of 100 for identical sequences, and about
>5 for completely unrelated sequences:
>
>Aligning Mary Scott with :
>      When Cold                Score: 42.05
>      Untitled                 Score: 40.91
>      Sir John Fenwick         Score: 42.05
>      Carraig's Rant           Score: 19.32
>      Fireman                  Score: 23.86
>
>Aligning When Cold  with :
>      Untitled                 Score: 46.74
>      Sir John Fenwick         Score: 34.78
>      Carraig's Rant           Score: 23.91
>      Fireman                  Score: 22.83
>
>Aligning Untitled with :
>      Sir John Fenwick         Score: 34.55
>      Carraig's Rant           Score: 17.27
>      Fireman                  Score: 21.82
>
>Aligning Sir John Fenwick with :
>      Carraig's Rant           Score: 15.79
>      Fireman                  Score: 16.36
>
>Aligning Carraig's Rant with :
>      Fireman                  Score: 32.73
>
>
>As you can see, the first four tunes show strong similarity
>with each other.  The last two form a separate group and
>are more strongly related to each other than to the others,
>although they all clearly are related.
>
>Even with this relatively crude conversion you should have
>no trouble pulling these tunes out of a database by searching
>with any of them.
>
>If I get the time I'll try them on some of the phylogenetic
>analysis programs tomorrow, and see if I can produce a
>family tree.And a later comment from Phil about an analysis using phylogenetic
software:> It was actually Joe Felsenstein's program Protpars which I used to
> produce the tree, rather than BLAST.  The latter is optimised to do
> zillions of comparisons very rapidly for database searching, while
> Protpars is part of the Phylip suite, and is used to generate
> phylogenetic trees.
>
> As it happens, Joe is not only a world expert in phylogenetic analysis
> but also a folkie who occasionally contributes to rec.music.folk. and
> I think he was quite tickled when I told him what I'd done with his
> program.I have a few more archived messages from similar discussions about
abusing molecular-biology software to analyze tunes, which included
this real doozy from the late Laurie Griffiths:: I had written a synthesiser program for an Amiga that mapped
: the keyboard into notes (a sort of cross between a melodeon
: and a button accordion) and to generate passwords I thought
: of a tune and just "played it".  So the Irish Washer Woman
: was rjhffbffhfhrkj and so on.  All was fine for a few months,
: then it started complaining that most of my new passwords
: were too similar to some old password.Password analyzers for musicology???-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: tune families & comparisons (long)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 22:47:31 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(127 lines)


Jack Campin wrote:
>
> I posted this to the ABC list a while back, as a challenge for
> anyone's
> algorithmic methods of tune comparison.
>
> X:1
> T:Mary Scott
> S:Agnes Hume's music book, 1704, Adv.MS.5.2.17
> Z:Jack Campin 1998-2000
> N:for some sort of lute
> N:original written on a six-line staff!
> M:6/4
> L:1/4
> K:Amix
> DEG "="A2[Bd]|"="A2[Bd] "="[F3/2A3/2]E/D|\
> EFA "="[B2d2][Ac]|"="[B2d2]A "="[B2d2]A|
> DEG "="A2[Bd]|"="A2[Bd] "="[F3/2A3/2]E/D|GA/G/F/E/ FG/F/E/D/|EFA
> "="[B2d2]A||
> "="[d3D3] "="d>cB|ABd "="[F3/2A3/2]E/D|"="[e3E3]
> "="e>de|"="fe"="d "="e>dc|
> "="[d3D3] "="d>cB|ABd "="[F3/2A3/2]E/D|GA/G/F/E/ FG/F/E/D/|EFA
> "="[B2d2]A|]
>
> X:2
> T:When ye Cold winter nights were frozen or The Banks of Yaro
> S:Thomson MS (1702), David Johnson's edition
> Z:Jack Campin 1998-2000
> N:for treble recorder
> M:6/4
> L:1/4
> K:GMix
> c>de  g2   e |gac' e2c |d e   f    a2    g     |a2       g
> a2c'|
> c>de  g2   e |gac' e>dc|f g/f/e/d/ e f/e/d/c/  |d  e     g
> a2g||
> c'2c' c'>d'e'|gac' e2c |d d'  d'   d'2   c'/d'/|e' f'/e'/d'/c'/
> a2g |
> c'2c' c'>d'e'|gac' e2c |f g/f/e/d/ e f/e/d/c/  |d  e     g
> a2g|]
>
> X:3
> T:untitled
> S:Cuming MS, 1723
> Z:Jack Campin 1998-2000
> N:for the fiddle
> M:3/4
> L:1/8
> K:Ador
> D3EFG|A4F2|A2.B2.d2|"="F3ED2|E2.F2.A2|B4(de)|f2(gf)"="e>d|"="B4A2
> |
> D3EFG|"="A4F2|A2.B2.d2|"="F3ED2|G2(AG)"="F>E|F2(GF)"="E>D|E2.F2.A
> 2|"="B4A2||
> d2D2d2|d3efe|d2A2Bd|"="F3ED2|e2E2de|"="e4de|f2(gf)"="e>d|"="B3ABc
> |
> d2D2d2|d3efe|d2A2Bd|"="F3ED2|f2(gf)"="e>d|B2(dB)"="A>G|E2.F2.A2|"
> ="B4A2|]
>
> X:4
> T:Sir John Fenwick's The Flower Amang Them All
> S:Northumbrian Pipers' Tune Book volume 1
> Z:Jack Campin 1998-2000
> M:3/4
> L:1/8
> K:Amix
> D3E FG|A2B2d2|A2B2d2|BA GFED|E3F  GA|B2 B2d2|B2B2d2|MB4 A2 |
> D3E FG|A2B2d2|A2B2d2|BA GFED|G2 AGFE|F2 GFED|E2F2A2|MB4 A2||
> d2D2F2|d2D2F2|d2D2d2|BA GFED|e2 E2G2|e2 E2G2|e2E2e2|MB4 A2 |
> d2D2F2|d2D2F2|d2D2d2|BA GFED|G2 AGFE|F2 GFED|E2F2A2|MB4 A2|]
>
> X:5
> T:Carraig's Rant
> S:NLS MS.21744, tunebook of John McKillop, fifer in the 42nd,
> 1813
> Z:Jack Campin 1998-2000
> M:4/4
> L:1/8
> K:D
> D3 F A/A/A AB|ABdA F/F/F FD|EFEF     B/B/B Bf|gfed  B2      A/B/d
> |
> D3 F A/A/A AB|ABdA F2    ED|GBGB     FAFA    |EFGA TB2
> (A/B/d):|
> dedf d/d/d dA|BAdA F/F/F FD|e>fef    e/e/e ef|gfed  B/B/B (TBA)
> |
> d3 f d/d/d dA|BAdA F/F/F FD|G/G/G GB F/F/F FA|EFGA TB2
> (A/B/d):|
>
> X:6
> T:The Smith's a Gallant Fireman
> S:the way people round Edinburgh play it in sessions
> Z:Jack Campin 1998-2000
> M:4/4
> L:1/8
> R:strathspey
> K:D
> % D major/mixolydian hexatonic
> D2 D>F A<AA>F|A>Bd>A F2E>D|E2 E>G B<BB>A|d>fe>d B2B<d|
> D2 D>F A<AA>F|A>Bd>A F2E>D|G>BG<B F>AF<A|E>FG>A B2A2||
> d>ef>e d<dd>A|B>Ad>A F2E>D|e2 e>f e2 e>f|g>fe>d B2A2 |
> d>ef>e d2 d>A|B>Ad>A F2E>D|G>BG<B F>AF<A|E>FG>A B2A2|]
>"Long Cold Nights" from 'Comes Amores', 1st book, 1687, is #292 in
Simpson's BBBM, and that, as an ABC, is B292 among the broadside
ballad tunes on my website. John Glen, in 'Early Scottish
Melodies', 1900, beat you to most identifications without computer
programs, and he gives the alternative titles you have (with some
spelling differences) and "Clurie's Reel". You can see a list of
titles and sources (including additional ones) under "Mary Scott"
in the Scots tune index on my website.The later titles:
Not noted by Glen (and, not in my index listing) are the more recent
"The Smith's a Gallant Fireman", and "Sir John Fenwick".
In Stokoe and Bruce's 'Northumbrian Minstrelsy", 1882, is given
the tune "Sir John Fenwick's the Flower Amang Them [All]", with
the note that the tune had appeared in McGibbon's Collection as
"Mary Scott" about 1740 [recte, McGibbon's 1st colln, p. 9, 1742] This
strongly implys that the tune title "Sir John" is later than 1742.
(The song is evidently lost.)Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: tune families & comparisons (long)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 30 Aug 2003 23:29:36 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(50 lines)


Bruce Olson wrote:
>
> Jack Campin wrote:> > X:2
> > T:When ye Cold winter nights were frozen or The Banks of Yaro
> > S:Thomson MS (1702), David Johnson's edition
> > Z:Jack Campin 1998-2000
> > N:for treble recorder
> > M:6/4
> > L:1/4
> > K:GMix
> > c>de  g2   e |gac' e2c |d e   f    a2    g     |a2       g
> > a2c'|
> > c>de  g2   e |gac' e>dc|f g/f/e/d/ e f/e/d/c/  |d  e     g
> > a2g||
> > c'2c' c'>d'e'|gac' e2c |d d'  d'   d'2   c'/d'/|e' f'/e'/d'/c'/
> > a2g |
> > c'2c' c'>d'e'|gac' e2c |f g/f/e/d/ e f/e/d/c/  |d  e     g
> > a2g|]Long Cold nights in 'Comes Amores' is termed 'A New Scotch Song'.
The text in 'Compleat Academy of Compliments', 1705, I haven't
seen. The early (before 1689) broadside ballad expansion is
reprinted (only) in 'Osterley Park Ballads', #26, where it it
entitled "The Scotch Lasses Choice" "To a pleasant New Scotch
Tune".Long Cold Nights, when Winter-Frozen,
Jockeys head lay on my Bosom;
Now each wanton Lass pursues him,
Ah-wa's me, that I must lose him;
Sawney and Jemmy came often to try me,
Philly and Willy would fain ligg by me;
But Alas! they do but Tease me,
Jockey, he alone can please me.
[6 more verses]The heroine isn't 'Mary Scot, the Flower of Yarrow', but
if the English say it's a 'New Scotch Tune" I can't see why the
Scots should object. That 'Banks of Yaro' subtitle, 1702, is also
pretty suggestive that the Scots knew it as a Scots tune at a pretty
early date.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: tune families & comparisons (long)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 04:26:40 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Jack Campin wrote:
>
> I posted this to the ABC list a while back, as a challenge for
> anyone's > algorithmic methods of tune comparison.Jack, too deep, too fast.What's an algorithm? My dictionary, 20 years old, has a definition
that's obviously 20 years older yet.I don't have one for tune comparison, and I doubt many here do. I can
see a brute force way to do something along that line with what I have
with a little programing on my ABC player. Since I can overlap two tunes
in the tune frequency display option, I can just figure out what % of
the time they are the same and what % they are different.
I have some doubts that would prove an adequate approach, because where
the tunes are different, I wouldn't know how much different.
E.g., I take a 3/4 tune that's all quarter notes and overlapping it with
itself and I get 100%. Now in a second copy of the tune I split each
note, overlap, and I'm down to 50%, no matter how big the splitting.
Where they are different I could total up how much different, summed
over the whole tune. What I don't know how to do is figure out if this
is meaningful.
I could shetch out starting theory for the recording of the music, with
information theory giving 2TW points in a .WAV file (T = recording time
in seconds, W = bandwidth in Hertz). Now for stressed note coding we
just figure out n so that every nth point is at the start of a stressed
note and throw all else away, so our data file is a factor of 10
smaller. But I don't think this is the place to try to develop that.

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 04:58:04 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(19 lines) , text/html(16 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tune Families
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 11:08:44 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(68 lines)


> Sameness might be defined as similar finger-patterns of playing-
> especially on the diatonic or cross-strung harp, where a simple
> shifting of the hands one string toward the player can change a
> tune from Ionian to Dorian, or from Dorian to Phrygian. On the
> penny whistle,  an Ionian tune in the key of the instrument has
> its tonic sounded when all six fingers are covering the holes; if
> the right middle finger be lifted from hole No. 6 or 1 (depending
> upon the orientation used) and the resulting sound taken as the
> tonic, the same pattern of fingering will give you the tune in the
> Dorian mode.I find it incredibly difficult to play tunes shifted by one finger
like that; I've been trying to relearn some of the same tunes I play
on whistle/flute/clarinet/recorder on the Italian ocarina.  My mental
model of the first four (all of which have six fingers down for the
lower tonic of an authentic major scale within the first-harmonic range)
says they're all variants of the same thing.  The ocarina (which puts
everything one finger position lower, i.e. the authentic-major tonal
centre has your right little finger down as well) feels utterly
different; I have to relearn most tunes individually.  I can't see a
process so mind-boggling being a practical means of creating variation.Duncan Johnstone's highland pipe march "Seonaid" is designed to be
played in two alternate positions one finger apart.  As a result its
note and interval patterns get BarFly's mode-guessing heuristics into
an unparalleled fankle.  Do a similar shift on any traditional tune
and it will be obvious that something has gone horribly wrong.> Or on the non-folk piano keyboard, a tune played entirely on the
> white keys with C as its tonic will be changed from Ionian to Dorian
> if D is used as the tonic, and still no black keys are used.David Johnson once pointed out to me in conversation that mode shifts
happen a lot in folk fiddling - some minor tunes become easier if your
finger drifts a bit and turns them dorian, and historically this seems
to have happened to some known-composer we-know-how-it-started-out
Scottish tunes once they got into the folk repertoire.  (The only
fretless stringed instruments I've played have been tuned in fourths
and with a large scale length; on those the drift tends to be the
opposite way, as a major third up from an open string is a long
stretch on a weak finger).> Bertrand Bronson diagrammed an interesting "mode star" on page xii of
> Volume 2 of his _Traditional Tunes of the Child Ballads_,  which shows
> how easily a performer could drop one of the tones (the 7th, for example)
> from the scale of a song, and how a subsequent singer might restore the
> "gap" by filling in the missing tone, but perhaps lowering it a half-
> step, thus, continuing the example, changing the "original" tune from
> Ionian to Mixolydian.I reinvented something similar with the "Big Picture" partial-order
diagram in the modes tutorial on my website, which characterizes the
same pattern of shifts in mode - mine has the advantage of omitting
modes that never occur in real music.  My motivation was different,
though: I was looking at the same sort of gap-filling and gap-opening
as a structural device in extended modal tunes like multi-part pipe
marches. Sometimes this is also diachronic, as the later parts of a
four- or six-part Scottish instrumental tune are often variations on
the earlier ones, written decades after.-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 07:00:40 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(29 lines) , text/html(21 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 11:59:58 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


[re Gilderoy]
>> The Star of the County Down is very recent - it was written by a man
>> from Ramelton in Donegal who spent most of his life in Dublin and died
>> in 1927.  Named Cathal McGarvey he is also credited with "The Devil
>> and Bailiff McGlynn." Before that, in Ireland, the tune was generally
>> called "My love Nell." and of course, in England, "Dives and Lazarus."
> The song, The Star of the County Down, is indeed very recent, but the
> tune is considerably older and extremely widespread. It is more than
> likely derived from a family of Gaelic airsWhy assume a Gaelic origin?  The earliest known version of "Gilderoy"
is attached to a literary English text on a Scots subject.  There are
textually-vaguely-similar Scottish Gaelic laments for other MacGregor
terrorists/freedom-fighters (similar in being long and woolly, at
least), but they don't use the "Gilderoy" tune.  And that tune is
more-than-coincidentally similar to "The Cuckoo's Nest"/"Come Ashore
Jolly Tar", which can be traced to the 16th century in England.So it seems most likely to me that whoever wrote "Gilderoy" adapted
a pre-existing tune for it already found all over the British Isles.
England being the most populous nation within these islands, simple
demographics says that's where it started out unless you have hard
evidence to the contrary.Unless somebody can find a comparably-early version from continental
Europe (e.g. liturgical chant, which would be consistent with the
unusually stepwise character of the tune).  Anyone?-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 07:17:17 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(19 lines) , text/html(9 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 07:39:02 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(37 lines) , text/html(21 lines)


Sorry, your browser doesn't support iframes.


Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 08:47:41 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(61 lines)


[unmask] wrote:
>
> In a message dated 8/30/2003 9:33:58 PM GMT Daylight Time,
> [unmask] writes:
>
>      In 'The Blarney Comic Song Book' Glasgow, Cameron &Ferguson,
>      n.
>      d. (c 1865?) "My Love Nell" is attributed to William
>      Carleton, and
>      has tune direction "Come all ye" (for which I have no
>      identification). Carleton was writing and singing songs in
>      Tony
>      Pastor's Opera Salon in New York City in the first half of
>      the
>      1860s, and the song may well be Irish/American (like his
>      "Lannigan's Wake" imitation of "Finigins' Wake" to Tony
>      Pastor's
>      tune "Lannigan's Ball"). [The Levy sheet music website
>      contains
>      other songs by him, and such as John F. Poole (Finigins'
>      Wake),
>      and Tony Pastor, but rarely any of their best known songs.]
>
> On the principle that it may have been that Shakespeare's plays were
> not written by him but by another person of the same name, I have to
> point out that there was a writer in Ireland of the name of William
> Carleton (1794-1869) - see Traits and Stories of the Irish Peasantry.
> He was familiar with traditional song and, while I doubt his being the
> author of this piece, and I don't know whether he quoted it at any
> time, it is not unknown for literary people to receive this kind of
> credit without it being deserved - for example Dion Boucicault for The
> wearing of the Green, AP Graves for the Jug of Punch.
>
> Is ther any evidence other than this attribution?
>
> John Moulden1: Correction. Words of Lannigan's Ball are by Tony Pastor. Music by
Neil Bryant. (Levy sheet music collection)
2: I have no other evidence for Wm. Carleton's authorship of "My Love
Nell"
3: I am unaware of any evidence that Dion Boucicault didn't write the
verses of "Wearing of the Green". Several copies (1865) are in the Levy
sheet music collection, all attributed to him.Levy collection dates of William Carleton's songs don't preclude him
from being your Irish writer of 1794-1869.A slightly condensed version of the 'Blarney Comic' songbook is 'Tony
Pastor's Irish American Comic Song Book', from the same publisher.
And yet again much the same is 'The Bould Soger Boy Irish Comic Song
Book', same publisher.
I did not carefully examine the latter two songbooks.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 09:27:51 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


[unmask] wrote:
>
> On the principle that it may have been that Shakespeare's plays were
> not written by him but by another person of the same name, I have to
> point out that there was a writer in Ireland of the name of William
> Carleton (1794-1869) - see Traits and Stories of the Irish Peasantry.
> He was familiar with traditional song and, while I doubt his being the
> author of this piece, and I don't know whether he quoted it at any
> time, it is not unknown for literary people to receive this kind of
> credit without it being deserved - for example Dion Boucicault for The
> wearing of the Green, AP Graves for the Jug of Punch.
>
> Is ther any evidence other than this attribution?
>
> John MouldenRef. O'Donoghue's 'The Poets of Ireland':
William C Carleton (the Irish-American songwriter), was born in Dublin
in 1827, and went to America in his youth. He claimed to be the nephew
of William Carleton the novelist (1794-1869), who apparently never left
Ireland or wrote any songs.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 10:02:03 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


----- Original Message -----
From: Bruce Olson <[unmask]><<Paul, sorry, but I take Ballad-L to be a forum for informed
intelligent discussion of all English language songs and tunes.
It has taken a long time to get some real experts on Scots songs
and music here, but we've got them now, and let's not drive them
away with narrow ethnocentric based names and terminology that
they may not understand. This isn't an American fiddlers forum.>>If they're informed and intelligent, surely they'll have heard of one of the
most commonly-found names for a tune. And if they're informed and
intelligent, they'll probably be willing to accept any of many names for a
tune; there *isn't* just one name for a tune in many cases. Some, such as
yourself, consider that the first title is THE title. Others, such as me,
prefer to use the title that's most likely to be recognized by the greatest
number of readers in this particular forum, the membership of which is
certainly worldwide, but still overwhelmingly North American. I think both
ideas have their strengths and weaknesses. And the forum also contains a
mixture of "experts" and "civilians"; I don't see a problem with that. In
fact, I consider it to be one of our strong points.Anyone driven away by such a description is a pedant with an inappropriately
low level of pain, and probably doesn't belong in a forum that is so base as
to allow in the riffraff such as myself.Paul

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 17:59:35 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(104 lines)


[Revised email from Anne Dhu MacLucas, quoted by permission, and
reformated from email to text file.][Anne-]I worked with Bayard directly for a few weeks, right when I was
in  the throes of my dissertation, and I can tell you that his
'method,' which is pretty much like those of most people who
track variants, was to have an enormous store of tunes in his
brain and mentally compare whatever version he was looking at
with that.  Of course, he also had a huge library at hand and
could look tunes up. The most frustrating thing about working
with his articles was that he seldom  even provided the examples
in a written-out form. For my  dissertation, I did look all those
up and put the array of tunes in the order suggested by him and
others (such as Barry and Jackson)--at least for one of the major
families (his so-called â??Villikins- Randallâ??).  But, like
you, I was frustrated by a lack of a method, so back in the 1980s
I devised, with lots of student helpers, a computer
program in C that combed through groups of tunes, pre-analyzed by
stressed tones, but otherwise completely intact, to find the
tunes that were 'most alike' in a numerical weighting system of
about 12 characteristics.  I've not used the program for a
while--I was on my way to producing a book using the method, but
got sidetracked by becoming a dean (which I'm now through with),
but it worked well.What one needed to do first, however, was to gather a group of
tunes for the comparison with a 'model tune,' which I picked to
represent each branch of a family--that was from the dissertation
research.By the way, I also had contact with Bayard later, after James
Cowderyâ??s article on tune family revisited was published in
Ethnomusicology.  We were both incensed with his basic
misunderstanding of what tune-family was about, and we even
started drafting a joint reply, but it never got off the ground,
since we each had multiple other projects.So that's the story in a nutshell.  I still hope someday to
produce the book, which I feel is much needed as an antidote to
the Bronson volumes (since in them tunes are basically organized
by text and a very suspect theory of mode).  The book has a
working title of 'A Thesaurus of Tune Families,' so that one
could use it a bit like a dictionary.  I was using my computer
storehouse of about 10,000 British-Irish-American folk tunes, but
I've had to change computers about ten times since then, so I'm
not sure whether they've all survived the translation.  Now that
I'm no longer a dean, perhaps I'll have the chance to find out!
At the moment, though, Iâ??m in the middle of a more congenial
book about oral tradition in American music, broadly construed,
which is about a third done.Meanwhile, however, a few articles have appeared, under both my
new and old names, that rely on some aspect of tune-family theory
and in some cases illuminate one small branch.  These are listed
below in reverse chronological order.Under name Anne Dhu McLucas:Musical notes for The Song Repertoire of Amelia and Jane Harris,
co-edited with Emily Lyle and Kaye McAlpine (Edinburgh: The
Scottish Text Society, 2002)â??Musical Theater as a Link Between Folk and Popular
Traditions,â?? with Paul F. Wells, Vistas of American Music:
Essays and Compositions in Honor of William K. Kearns,  ed. John
Graziano (Detroit: Harmonie Park Press, 1999)Article on "Tune Families" for The New Grove Dictionary of Music
and Musicians, Stanley Sadie, editor (London: MacMillan
Publishers, revised edition, 2000)Obituary: "Samuel Preston Bayard:  1908-1997," Folk Music Journal
(1997), 392-393.â??The Multi-Layered Concept of â??Folk Songâ?? in American
Music: The Case of Jean Ritchieâ??s â??The Two Sistersâ??,â??
Themes and  Variations:
Writings on Music in Honor of Rulan Chao Pian, ed. Bell Yung and
Joseph S.C. Lam (Cambridge, MA, Harvard University Music
Department, 1994), 212-230.Under name of Anne Dhu Shapiro:"Black Sacred Song and the Tune-Family Concept" In Search of New
Perspectives in Music: Festschrift Eileen Southern,  eds.
Josephine Wright and Samuel Floyd.  (Warren, MI:  Harmonie Park
Press. 1992)"Sounds of Scotland in 19th-Century America," American Music  8
(1990), 71-83."Folk Music in Victorian Britain: an Encyclopedia, ed. Sally
Mitchell,  (New York: Garland, 1988) "Regional Song styles: The Scottish Connection," in Music and
Context: Essays for John Milton Ward, ed. Anne Dhu Shapiro
(Cambrige, MA:  Harvard University, 1985)[Anne Dhu McLucas]
........................Bruce Olson

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 31 Aug 2003 18:27:35 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


[unmask] wrote:> ... it is not unknown for literary people to receive this kind of
> credit without it being deserved - for example Dion Boucicault for The
> wearing of the Green, AP Graves for the Jug of Punch.
>> John MouldenJohn, there are about a half a dozen songs called "The Wearing of the
Green", and 1 or 2, I think, that I haven't seen. The ones I have seen
have no textual relation to the one popularly attributed to Dion
Boucicault, so I don't know what to think about your implication that he
got undeserved credit.The earliest one I know of is that (SITM #6187) in 'The Citizen', 1841.
A broadside reissue can be seen on the internet at the Minnesota
broadside website (search title on Google). SITM #6199 I haven't seen.
There are something like 3 or 4 more on the Bodleian Ballads website.
Where is any earlier than Boucicault's that he might have borrowed from?Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 04:59:41 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(21 lines) , text/html(11 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 05:06:52 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(37 lines) , text/html(32 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 05:08:06 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(15 lines) , text/html(14 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 11:27:44 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(61 lines)


[Gilderoy]
> A.L. Lloyd was fond of citing this family of tunes as probably
> the most widespread in England, whilst overlooking the fact that
> some members of the family are composed of two parts; an uncommon
> feature among English folksong melodies. This suggests to me that
> the origins of this particular family lie in Ireland, among the
> family of 2 part Gaelic airs which I mentioned in my previous email.*If* your generalization were true, the most it would indicate would
be that some members of the family had been restructured under Irish
influence.  I know somebody who likes to play "Soldier's Joy" in the
freygish scale; it doesn't make it a Yiddish tune, that version is his
invention.  (The second parts added to "Gilderoy" are quite variable
and usually not very original, which argues against them having been
there from the start).But since the oldest members of the "Gilderoy" family were first written
down long before any two-part Irish tune, what evidence is there that
this two-part structure was a constituent of Irish music early enough
to have an influence?There are many two-part dance tunes from England and Scotland as
early as the beginning of the 17th century, and English songs with
multi-part forms are far older - e.g. The Prisoner's Song ("Ar ne
kuthe ic sorghe min") from around 1250, which is a pretty normal
two-part piece you could play in any Irish folk session and have
everybody assume it was by Carolan, or "Worldes Blis" (same period)
with two four-line parts and a two-line tag.  English songs with
choruses go back to the Middle Ages - the Agincourt Carol is a two-
parter.  (Though a quick flip through the literature suggests that
religious songs were much more likely to have choruses than secular
ones).Further, the only Irish music older than the "Gilderoy" family that
we can plausibly claim to know in a reasonably coherent form is harp
tunes of the sixteenth century, which are rhapsodically-structured
things that neither fall into distinct parts nor have much in common
with any present-day folk music from either side of the Irish Sea.So how could you tell that the Gaelic two-part form itself wasn't an
English import?> It's entirely possible of course that some Irish musician adapted
> a pre-existing melody and turned it into the air which we know
> today as Liam Ó Raghaillagh.Is that song about a datable event?  If so, when was it?> But, as far as England is concerned, I think an Irish ancestry for
> Lloyd's family of tunes is more likely than not.How do you propose to get that tune from the west of Ireland into the
general corpus of English folksong by around 1600 without leaving any
written trace of its route of passage?-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack/>   *   homepage for my CD-ROMs of Scottish traditional music; free stuff on food intolerance, music and Mac logic fonts.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 08:24:44 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(30 lines)


[unmask] wrote:
>
> In a message dated 8/31/2003 2:26:51 PM GMT Daylight Time,
> [unmask] writes:
>
>      Ref. O'Donoghue's 'The Poets of Ireland':
>      William C Carleton (the Irish-American songwriter), was born
>      in Dublin
>      in 1827, and went to America in his youth. He claimed to be
>      the nephew
>      of William Carleton the novelist (1794-1869), who apparently
>      never left
>      Ireland or wrote any songs.
>
> Thank you. You are thorough!
>
> JOhnMostly on whim, I picked up the reprint of O'Donoghue's 'The Poets of
Ireland' for 2 or 3 dollars. O'Donoghue is carefull to note if his
authors are known to have written songs, and he includes Irish-American
authors.
The book proved to be a lucky investment.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 11:08:41 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(41 lines)


[unmask] wrote:
>
> Thank you for this. I need to check in detail but the attribution to
> Boucicault appears to rest on his having included it in a play. There
> are very similar songs, like "Green on the Cape" which clearly
> ante-date the play in question.
>
> The writer William Carleton never went to USA. His writing on Irish
> subjects made him well enough known to warrant the award of a Civil
> List pension of £200 a year. He died in Dublin.
>
> I'm away for the week so any delay in reply will be repaired on my
> return.
>
> JohnThe play for Boucicault's "Wearing of the Green" was 'Arrah na
Pogue', 1865. I think the premier was in Paris.For texts of "The Wearing of the Green" on the Bodleian Ballad
Website we have Harding B 18(476) and Harding B 18(729) sung by
T[homas]. H. Glenny from a production of 'Arrah na Pogue' at
Niblo's Garden (New York). But when we look at the two texts, we
find these aren't even the same song! One is an extension of
Boucicault's song.Another on the Bodleian ballads website, 2806 c.15(254), was sung
by O'Sullivan in 'Arrah na Pogue' at the Theatre Royale, not
further specified (song recognizeably Boucicault's). I don't even
know how many Theatre Royales there were c 1865-70. This one has
a tune direction, "Nearly Sae will we yet" [What's that?][I presume all here know that the tune is James Oswald's "The
Tulip". An ABC from it's original publication is on my website.]Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Shapiro's tune-family thesis
From: Cal & Lani Herrmann <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 1 Sep 2003 15:11:55 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


Hi Bruce and all,
        I was away for the past week, and returned to find Bruce's Wish posted
on this list.
        There is a copy of Ann Dhu Shapiro's dissertation in the music
library at Berkeley, and I have a photocopy of that.  I believe the late
Prof. Bertrand Bronson had a hand in obtaining it for the library, or
perhaps the author (whose name I believe is now Ann Dhu McLucas) sent
him or the library a copy.  At any rate, there it is.  A bit too late,
but ... -- Aloha, Lani<||> Lani Herrmann * [unmask] (or: [unmask])
<||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Applied Research in Folklore
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 01:28:06 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(41 lines)


I have previously cited an article in JAF, by Anne and Norm
Cohen, as giving a very practical scientific methedology for
discovering the best possible 'truth' from a set of accurate
data. Remmber, we can't turn the study of folklore into a
science, but we can profitably use scientic methods to good
purpose in our research into the subject.Scientists, however, are not sufficiently holy that they can
dispense with common trivalities like food and drink, etc, so to
make some money they are some times forced to adopt a different
modus operandi as regards their research. Such research isn't
directed to giving us our best understanding of the data, but,
called 'applied research', is directed at finding how quickly one
can get a 'good' (quick, cheap, practical) desired result. The
crudest approach is no more than a series of 'trial and error'
sequences (and I must admit that some theoretical 'common-sense'
guidance here, no matter how unsophisticated, may facilitate a
more rapid and economical solution).The 'trial and error' approach is sometimes inefficient, but
is itself, is a time honored tradition, so we need not apologize
for citing an example of its effective use. Data gathering for this
project has proceeded as best as could be done in the past, but some
inadequecies are quite obvious, and we have confident expectations of
supplementing the data in the near future.At the click following you will see a little of an early (c
1740), and entirely experimental approach, of A Scots or Irish
lass directed to solving the pressing and practical problem of
finding a penis of adequate fit and function.<A href="http://www.erols.com/olsonw/SONGTXT2.HTM"> find Moreen
in index below, and click again </a>Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 10:18:56 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


Bruce Olson wrote:
>
> <A href="http://www.erols.com/olsonw/SONGTXT2.HTM"> find Moreen
> in index below, and click again </a>
>Sorry. The reference to the wrong tune file for the ABCs has now been
changed to the correct one.Bruce Olson

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 12:04:02 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(22 lines) , text/html(31 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 13:12:00 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


dick greenhaus wrote:
>
> Let's hear it for the experimental method!
>
> Bruce Olson wrote:
>
>      Bruce Olson wrote:
>
>
>           <A href="http://www.erols.com/olsonw/SONGTXT2.HTM"
>           > find Moreen
>           in index below, and click again </a>
>
>
>
>      Sorry. The reference to the wrong tune file for the ABCs has
>      now been
>      changed to the correct one.
>
>      Bruce Olson
>
>I've used the Irish Moreen/Maureen beecause I haven't found an old Scots
Gaelic title where the correct Morag/Marion is easily recognized. Jack
Campin has more that a little about this and about use of at least one
of our tunes elsewhere.--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: Alan Ackerman <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 18:06:56 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


>Bruce Olson wrote:
>>
>  > <A href="http://www.erols.com/olsonw/SONGTXT2.HTM"> find Moreen
>  > in index below, and click again </a>
>>
>
>Sorry. The reference to the wrong tune file for the ABCs has now been
>changed to the correct one.
>
>Bruce OlsonI've tried eight different browsers -- the songs not there. The page
ends with the line:Tommy Linn, and his wife, and his wifes mothe
--
Alan Ackerman, [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 22:20:49 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


Alan Ackerman wrote:
>
> >Bruce Olson wrote:
> >>
> >  > <A href="http://www.erols.com/olsonw/SONGTXT2.HTM"> find Moreen
> >  > in index below, and click again </a>
> >>
> >
> >Sorry. The reference to the wrong tune file for the ABCs has now been
> >changed to the correct one.
> >
> >Bruce Olson
>
> I've tried eight different browsers -- the songs not there. The page
> ends with the line:
>
> Tommy Linn, and his wife, and his wifes mothe
> --
> Alan Ackerman, [unmask]Sorry, I found that I made several errors regarding placement of text in
the file, with clicks-ons from various spellings of corrupt Scots and
Irish Gaelic titles, and have had to make several revisions of the file
today.
I hope I have it correct now, so how about trying again now, and if it
doesn't work for you, let me know here, or via private email, and I'll
try to get it fixed.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 22:51:42 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


Alan Ackerman wrote:
>
> >Bruce Olson wrote:
> >>
> >  > <A href="http://www.erols.com/olsonw/SONGTXT2.HTM"> find Moreen
> >  > in index below, and click again </a>
> >>
> >
> >Sorry. The reference to the wrong tune file for the ABCs has now been
> >changed to the correct one.
> >
> >Bruce Olson
>
> I've tried eight different browsers -- the songs not there. The page
> ends with the line:
>
> Tommy Linn, and his wife, and his wifes mothe
> --
> Alan Ackerman, [unmask]Another report of trouble!  The Moreen/Morag subfile is the 3rd from
the end of the full file, so scroll to end and back up to get there,
while I try to figure out what's wrong.Call is from #MOREENG in index to MOREENG at target (and SEARCH finds
both so spelling is correct) which looks right, but doesn't work. Now I
have to figure out why.Bruce Olson
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Applied Research in Folklore
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 2 Sep 2003 23:10:59 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


Bruce Olson wrote:
>
> Alan Ackerman wrote:
> >> I hope I have it correct now, so how about trying again now, and if it
> doesn't work for you, let me know here, or via private email, and I'll
> try to get it fixed.
>
> Bruce Olson
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> subject index) </a>I made an error in terminating a target name in a section prior to that
of Moreen/Morag, but HTML is a vengeful god that tolerates no errors,
and punishes when he gets the chance. The click-on now works for me, so
for the present he appears to be appeased.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Morag/Moreen
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 10:36:16 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Wm. Chappell, PMOT, II, p. 684, says "Touch the Thing" was a vulgar
song with a good tune (Push about the Jorum), so other words were
written for the tune in 'The Golden Pippin', 1773.
Has anyone here seen a copy, or know of a copy of "Touch the thing"?
This is a side issue, because the bawdy song "The Summer Morn" in
the 'Merry Muse of Caledonia' (Legman's ed., p. 49) gives "Push about
the Jorum" as the tune direction, but my main interest is as follows.In Robert Burns' holograph he gives the tune for "The Summer Morn" as
"The Tither Morn" (from Scots Musical Museum, #345), known as "The
Moreen" for Thomas Moore's "The Minstrel Boy" and given from a MS of
1787 as "Moreen" in the Complete Petrie collection, #1067.Do we have another Gaelic tune stemming from "Morag (Scots)/ Moreen
(Irish) the beggar's daughter"?With the most recently collected version (by Jim Carroll) of "Morag
the beggar's daughter" yet to be published, we seem to have a fair
amount of evidence for a purely oral survival of an old bawdy song.
John Moulden knows about an early 20th century Irish version of the
song that I haven't seen, and that one isn't yet in Steve Roud's folk
song index.--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Chris Powell/Our Goodman, etc.
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 10:15:11 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(83 lines)


Hi folks:This discussion started on another list; I'm forwarding it with the author's
permission.Peace,
Paul----- Original Message -----
From: Howard Rye <[unmask]>
Sent: Tuesday, September 02, 2003 12:03 PM
Subject: Chris Powell/Our Goodman, etc.The French Classics label have just reissued the Columbia and Okeh
recordings of Chris Powell and The Five Blue Flames (Classics 5065). This CD
is reviewed by Keith in Blues & Rhythm 182 rather unfavourably and it
certainly contains some dogs, though whether it sets the scene for the
emergence of Ray Conniff as Keith suggests I really cannot say since I have
never knowingly heard Ray Conniff!More interesting from the standpoint of this list is that Last Saturday
Night (14 April 1949, Columbia 30162), as noted by Keith, is a version of
the Child ballad Our Goodman.I have no desire whatever to get involved in arguments about authenticity or
what is or is not folk music, least of all with you lot, but this does
prompt me to ask whether anyone knows of a later recording of a Child ballad
which was not primarily aimed at people who know what a Child ballad is. I
think this formulation avoids the unwanted overtones but I could well be
wrong. There may be dozens for all I know but I can't think of any.For ease of comparison with other versions, I have transcribed the lyrics,
which are as follows. Powell himself claimed composer credit (confirmed from
a scan of the label). The failure of any facilitator to claim a share of the
gravy might be due to even A & R men sometimes having a conscience, but it
might also indicate that the number belonged to Powell's normal repertoire.
It would be fascinating to know the history of its appearance here. We know
from Coley Jones's version that it was in some sense in African-American
tradition.Last Saturday night when I came home, just as high as I could be,
I seen a hat layin' on the rack where my hat's supposed to be.
Well, I said to my wife, my pretty little wife, explain this jive to me,
Tell me what is that hat doin' on the rack where my hat's supposed to be.
She said, "Chris, you fool, you big fat fool, can't you plainly see,
That's nothin' but an old fryin' pan that your mother sent to me."
Well, I've traveled the world for many a mile and I hope to travel some
more,
But I never have seen a frying pan with a hat band in the fore.
And I said, "Mama, hey pretty baby, ooh little mama, explain this jive to
me!"Now, last Saturday night when I came home, just as drunk as I could be,
I seen a head layin' in the bed where my head's supposed to be.
Well, I said to my wife, my pretty little wife, explain this jive to me,
Tell me what is that head doin' in the bed where my head's supposed to be.
She said, "Chris, you fool, you big fat fool, can't you plainly see,
That's nothin' but an old cabbage head that your mother sent to me.
Well, I've traveled the world for many a mile and I hope to travel some
more,
But I have never seen a cabbage head with Vaseline on it before.
And I said, "Mama, hey pretty baby, ooh little mama, explain this jive to
me!"Now, last Saturday night when I came home, just as drunk as I could be,
I seen a leg out from underneath the bed where no leg is supposed to be.
Well, I said to my wife, my pretty little wife, explain this jive to me,
Tell me what is that leg doin' out from under the bed where no leg is
supposed to be.
She said, "Chris, you fool, you big fat fool, can't you plainly see,
That's nothin' but an old antique chair that your mother sent to me."
Well, I've traveled the world for many a mile and I hope to travel some
more,
But I have never seen an antique chair with a seat like that before.Howard Rye
[unmask]
20 Coppermill Lane,
London,
E17 7HB
Tel/FAX: +44 20 8521 1098

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Morag/Moreen
From: Ed Cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 08:45:16 -0700
Content-Type:TEXT/PLAIN
Parts/Attachments:

TEXT/PLAIN(5 lines)


Folks:Has anyone published a text of this purportedly old bawdy song?Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Morag/Moreen
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 12:18:12 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


Ed Cray wrote:
>
> Folks:
>
> Has anyone published a text of this purportedly old bawdy song?
>
> EdThere are many. Bibliography and oldest known text given in the file
here: (it may take a minute to load the file)
<A href="http://www.erols.com/olsonw/SONGTXT2.HTM"> find
Moreen/Moarag in index, and click again to go to song file</a>Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Morag/Moreen
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 13:12:32 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(26 lines)


Ed Cray wrote:
>
> Folks:
>
> Has anyone published a text of this purportedly old bawdy song?
>
> EdThe version in Gmelch's 'Tinkers and Travelers', 1975, "Marie
from Gippursland", is, according to Steve Roud's folk song index
(#7269) on a CD recording from 'Musical Traditions', CD 325-6,
"Puck to Appleby". It is sung by the traditional singer, Bill Bryan.I can't find it on Dick G's Camsco Music website.I perhaps stretched it by saying many. There's the mid 19th century text
from Northumberland (on my website); text and fragment in Greig-Duncan
coll'n, #1434; Jolly Weaver in JIFSS (early 20th century), Gmelch's
above; unpublished collected by Jim Carroll.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 12:24:19 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


Back in my youth I was surprised to hear a "folk" version of "Our
Goodman," I knew it as "Wake Up Baby" by Sonny Boy Williamson (Rice
Miller) [Checker 894 @ 1956]. I also recall versions by Blind Lemon
Jefferson ("Laboring Man Away From Home" [unissued 1927]) and Colon
Keel's "The Three Nights Experience" recorded for the Library Of
Congress @[unmask]Meade/Spotswood devotes 16 pages to "country" recordings of British
ballads [5 pages of Child, 11 pages of Laws]. Versions of "Our Goodman"
recorded between 1926 and 1954 include "Three Nights Experience" [Gid
Tanner, Earl Johnson, John Evans, Homer & Jethro]; "Four Nights
Experience" [Thomas C Ashley]; "Five Nights Experience" [Mustard &
Gravy]; "Six Night's Drunk" [Bankston & Henderson]; John The Drunkard
[Carson Robison, Asa Martin]; ""Three Nights In A Bar Room" [Wade
Mainer]. I also seem to recall a version recorded by Bob Wills in the
mid to late 50s but can't put my finger on the specifics at the moment.Cliff OCHELTREE
N. O. LA

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Morag/Moreen
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 17:01:56 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(45 lines) , text/html(54 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Child Recordings
From: Ed Cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 14:48:07 -0700
Content-Type:TEXT/PLAIN
Parts/Attachments:

TEXT/PLAIN(7 lines)


Folks:There have been recordings by classical singers attempting what is now
called "crossover" who sang the "Scarlet Town" variant of "Barbara Allen"
(Child 84).  One shudders --Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child Recordings
From: Sandy Ives <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 18:20:29 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(2 lines)


Like John Charles Thomas singing "Lord Randal."
Sandy

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Preliminary Ebay List - 09/03/03
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 18:36:14 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


Hi!        This is a preliminary list covering the next couple of days. The
full list will appear probably on some time on Friday.        SONGBOOKS, ETC.        3547747133 - Folk Tunes From Mississippi by Hudson & Herzog,
1977 reprint, $19.99 (ends Sep-04-03 19:38:30 PDT)        3547864158 - The Seven Seas Shanty Book by Sampson, 1927, $6.99
(ends Sep-05-03 12:26:25 PDT)        3547932342 - Australian Colonial Ballads by Anderson, 1962
edition, $8 (ends Sep-05-03 19:53:49 PDT)        3548089529 - Folk Songs of Old New England by Linscott, 1939,
$9.99 (ends Sep-06-03 15:57:48 PDT)                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child Recordings
From: "Thomas H. Stern" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 19:14:43 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


Some are not awful, some hideous!
On another track there was the Leonard Warren Sings Sea Shanties.....
I seem to remember that in the notes to one of the early Library of Congress
recordings the point was made that Rebecca Tarwater(?)  was classically
trained (she sang Barbara Allen, if memory serves.)
  Best wishes, Thomas SternEd Cray wrote:> Folks:
>
> There have been recordings by classical singers attempting what is now
> called "crossover" who sang the "Scarlet Town" variant of "Barbara Allen"
> (Child 84).  One shudders --
>
> Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 19:37:20 EDT
Content-Type:text/plain
Parts/Attachments:

text/plain(77 lines)


I recorded "Our Goodman" (under that name)  on my Decca album _Singing Across
the Land_  in 1955;  it's now out of print.  I had learned it in Crockett,
Texas, in about 1932--more than 20 years before recording it.  Lots of my
friends at Crockett High School had seemed to know it.  This was long before I had
heard of Francis James Child,  and we called it "Three Nights Drunk."  The
words were:    The first night when I came home
        As drunk as I could be
    I saw a horse in the stable
        Where my horse sought to be.            I called to my little wife, and said
                "Explain this thing to me;
            How come a horse in the stable there
                Where my horse ought to be?"    "You blind fool! You crazy fool!
        You ignorant fool!" said she.
    "It's nothing but a milk-cow
        My Mama sent home to me."I've roamed the wide world over,
    Of sights I've seen a score,
But a saddle on a milk-cow
    I never had seen before.    The second night when I came home,
        As drunk as I could be.
    I saw a coat on the hanger
        Where my coat ought to be.            I called to my little wife, and said
                "Explain this thing to me;
            How come a coat on the hanger there
                Where my coat ought to be?"    "You blind fool! You crazy fool!
        You ignorant fool!" said she.
    It's nothing but a bed quilt
        My Mama sent home to me."I've roamed the wide world over,
    Of sights I've seen a score,
But a pocket on a bed quilt
    I never had seen before.    The third night when I came home
        As drunk as I could be
    I saw a head on the piller there,
        Where my head ought to be.            I called to my little wife, and said
                "Explain this thing to me;
            How come a head on the piller there
                Where my head ought to be?"    "You blind fool! You crazy fool!;
        You ignorant fool!" said she.
    "It's nothing but a cabbage head
        My Mama sent home to me."I've roamed the wide world over,
    I've sailed from shore to shore,
But a  cabbage-head with a mustache
    I never had seen before.
***********************************
In Crockett, this was not considered a naughty song, but Prof. D. K. Wilgus
at UCLA  knew some even raunchier versions. One was called "FIVE Nights Drunk"
and it became more explicit in each succeeding verse. In one European version
I've read about, the husband impales the supposed cabbage-head on his sword
and presents it to his wife, ordering her to cook it for dinner.Sam Hinton
La Jolla, CA
[unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child Recordings
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 20:34:27 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(44 lines)


Thomas H. Stern wrote:
>
> Some are not awful, some hideous!
> On another track there was the Leonard Warren Sings Sea Shanties.....
> I seem to remember that in the notes to one of the early Library of Congress
> recordings the point was made that Rebecca Tarwater(?)  was classically
> trained (she sang Barbara Allen, if memory serves.)
>   Best wishes, Thomas Stern
>
> Ed Cray wrote:
>
> > Folks:
> >
> > There have been recordings by classical singers attempting what is now
> > called "crossover" who sang the "Scarlet Town" variant of "Barbara Allen"
> > (Child 84).  One shudders --
> >
> > EdMy take is listening to recordings of traditional singers, or,
performers that can do the stuff and studied hard to know exactly where
it came from (often going themselves to hear the oldtimers and talk to
them, and look at their 'environment' [From the horse's mouth]).
Classical singers renditions are just good for laughs at what show biz
thinks we are idiots enough to accept as out heritage.Last year there was a production at Ford's Theater in Washington DC,
which was based on old Appalachaian and Bluegrass music. The Washington,
DC, area is loaded with good performers that do it very well, ('normal'
folk and semi-retires from Nashville) and know the background
intimately. Not a one was in that production. I canceled out when I saw
the cast, and their credits for performing in theater productions, and
their acting and music shool credentials.How about some further comments by knowledgeable people here, like Mary
C., and one of our lurkers, S. W.? [I think our lurkers here know more
about what we discuss than we do.]Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 20:46:43 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(94 lines)


[unmask] wrote:
>
> I recorded "Our Goodman" (under that name)  on my Decca album _Singing Across
> the Land_  in 1955;  it's now out of print.  I had learned it in Crockett,
> Texas, in about 1932--more than 20 years before recording it.  Lots of my
> friends at Crockett High School had seemed to know it.  This was long before I had
> heard of Francis James Child,  and we called it "Three Nights Drunk."  The
> words were:
>
>     The first night when I came home
>         As drunk as I could be
>     I saw a horse in the stable
>         Where my horse sought to be.
>
>             I called to my little wife, and said
>                 "Explain this thing to me;
>             How come a horse in the stable there
>                 Where my horse ought to be?"
>
>     "You blind fool! You crazy fool!
>         You ignorant fool!" said she.
>     "It's nothing but a milk-cow
>         My Mama sent home to me."
>
> I've roamed the wide world over,
>     Of sights I've seen a score,
> But a saddle on a milk-cow
>     I never had seen before.
>
>     The second night when I came home,
>         As drunk as I could be.
>     I saw a coat on the hanger
>         Where my coat ought to be.
>
>             I called to my little wife, and said
>                 "Explain this thing to me;
>             How come a coat on the hanger there
>                 Where my coat ought to be?"
>
>     "You blind fool! You crazy fool!
>         You ignorant fool!" said she.
>     It's nothing but a bed quilt
>         My Mama sent home to me."
>
> I've roamed the wide world over,
>     Of sights I've seen a score,
> But a pocket on a bed quilt
>     I never had seen before.
>
>     The third night when I came home
>         As drunk as I could be
>     I saw a head on the piller there,
>         Where my head ought to be.
>
>             I called to my little wife, and said
>                 "Explain this thing to me;
>             How come a head on the piller there
>                 Where my head ought to be?"
>
>     "You blind fool! You crazy fool!;
>         You ignorant fool!" said she.
>     "It's nothing but a cabbage head
>         My Mama sent home to me."
>
> I've roamed the wide world over,
>     I've sailed from shore to shore,
> But a  cabbage-head with a mustache
>     I never had seen before.
> ***********************************
> In Crockett, this was not considered a naughty song, but Prof. D. K. Wilgus
> at UCLA  knew some even raunchier versions. One was called "FIVE Nights Drunk"
> and it became more explicit in each succeeding verse. In one European version
> I've read about, the husband impales the supposed cabbage-head on his sword
> and presents it to his wife, ordering her to cook it for dinner.
>
> Sam Hinton
> La Jolla, CA
> [unmask]If you want some laughs look at rec.music.folk and watch for all the
recurring threads with commentaries on versions of this song, (There's a
thread now), and all the arguments about how many drunken nights there
were, and what happens on what night.Joe Hickerson, in his young and naieve days, planned to study all the
versions of "Our Goodman", but discovered that there was no end to the
data, so it wasn't possible. [Lurking yet, Joe?]Bruce OlsnRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Our Not-so-Goodman
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 3 Sep 2003 20:31:01 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


Folks:Sam Hinton wrote:In Crockett (Texas), this was not considered a naughty song, but Prof. D. K. Wilgus at UCLA  knew some even raunchier versions. One was called "FIVE Nights Drunk" and it became more explicit in each succeeding verse. In one European version I've read about, the husband impales the supposed cabbage-head on his sword and presents it to his wife, ordering her to cook it for dinner.And Ed Cray would humbly ask:Which is the more obscene, the frankly murderous or the frankly suggestive?Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child Recordings
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 01:08:16 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(9 lines)


<<There have been recordings by classical singers attempting what is now
called "crossover" who sang the "Scarlet Town" variant of "Barbara Allen"
(Child 84).  One shudders -->>I've heard some of them, not only on "Barbara Allen" but other Child
ballads. I didn't shudder; I screamed. And dove for the radio dial.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 02:12:34 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


----- Original Message -----
From: <[unmask]><<In Crockett, this was not considered a naughty song, but Prof. D. K.
Wilgus
at UCLA  knew some even raunchier versions. One was called "FIVE Nights
Drunk"
and it became more explicit in each succeeding verse. In one European
version
I've read about, the husband impales the supposed cabbage-head on his sword
and presents it to his wife, ordering her to cook it for dinner.>>Sam, that's interesting. In his notes on the song, A. L. Lloyd asked, "What
ancient tale of trickery and revenge lies behind this jokey song, common all
over Europe and turning up frequently in America and Australia? ... No
struggle takes place; there is no retribution; a joke's a joke and that's
that. Yet somehow in the form and atmosphere of the song, there's a sense of
something beyond the joke, something that suggests important things had
happened before the song begins and that perhaps terrible events may occur
after the song has ended. What is now a comic song may be but a portion of
another ballad, an old and tragic tale of adultery and revenge whose most
formal, most memorable passage has broken off and now lives on as a
burlesque."The version to which Sam refers is the first time I've heard of Lloyd's
"perhaps terrible events" being made explicit.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 06:17:32 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(39 lines) , text/html(34 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Simon Furey <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 13:10:01 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(71 lines)


Chaps,
In fact there's no need for tentative speculation with regard to the age of
the song family of "Our Goodman"; it's extremely old. The song has relatives
in Spain in both the Castilian and Catalan traditions. Colin Smith in his
"Spanish Ballads" (Oxford: Pergamon, 1964 repr 1971) gives a Castilian
version on pp. 197-199 and cites the source as the Cancionero de Romances de
Amberes, dating from approximately 1548. Both the Castilian and Catalan
versions are serious; the returning husband finds a horse in the stable,
discarded weapons, etc. and the wife makes all kinds of feeble excuses for
each item found until she finally admits her guilt and begs for death. Child
makes passing comment on these versions in his notes on no. 274, but fails
to draw out the closeness of the Castilian plot to the English one.
Cheers
Simon----- Original Message -----
From: "Fred McCormick" <[unmask]>
To: <[unmask]>
Sent: Thursday, September 04, 2003 11:17 AM
Subject: Re: Our Goodman> Hi Paul,
>
> By notes, I presume you're talking about record sleeve notes. In fact, the
> piece echoes a passage in Folk Song in England, where Lloyd speculates on
the
> antiquity of various ballads, principally The Outlandish Knight. It's all
very
> tentaive, but you can find it in the chapter on The Big Ballads. Lloyd
seems to
> be drawing most of his ideas from the Hungarian, Lajos Vargyas
>
> Cheers,
>
> Fred McCormick.
>
> In a message dated 04/09/2003 08:14:07 GMT Standard Time,
[unmask]
> writes:
>
>
> >
> > Sam, that's interesting. In his notes on the song, A. L. Lloyd asked,
"What
> > ancient tale of trickery and revenge lies behind this jokey song, common
all
> > over Europe and turning up frequently in America and Australia? ... No
> > struggle takes place; there is no retribution; a joke's a joke and
that's
> > that. Yet somehow in the form and atmosphere of the song, there's a
sense of
> > something beyond the joke, something that suggests important things had
> > happened before the song begins and that perhaps terrible events may
occur
> > after the song has ended. What is now a comic song may be but a portion
of
> > another ballad, an old and tragic tale of adultery and revenge whose
most
> > formal, most memorable passage has broken off and now lives on as a
> > burlesque."
> >
> > The version to which Sam refers is the first time I've heard of Lloyd's
> > "perhaps terrible events" being made explicit.
> >
> > Peace,
> > Paul
> >
>
>
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child Recordings
From: "Lisa - S. H." <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 09:47:59 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(41 lines)


At 01:08 AM 9/4/03 -0500, you wrote:>I've heard some of them, not only on "Barbara Allen" but other Child
>ballads. I didn't shudder; I screamed. And dove for the radio dial.
>
>Peace,
>PaulSometimes, however, if the guilty singer sites a specific reference that
they based their rendition on, and if that version has an interesting
melody variation or verse, then that can lead one to investigate that
source further and discover some nice versions to study.  A couple of years
ago I heard Custer LaRue's (she's more known for recording with the
Baltimore Consort) "Appalachian" version of The Wife of Usher's Well, and
found I liked a particular way the melody turned, despite inwardly cringing
at her classical (and lovely) voice attempting 1915 versions of ballads
from the southern mountains, Virginia and Kentucky, etc.   She cited Cecil
Sharpe's Southern Appalachian source book and (after recovering) I then
wound up reading through all the various versions he had written down, and
finding some nice things in there because of it.  I then learned a
different version to sing that I liked better than the one I had been
singing.  I guess that's something good.
A musical friend recently told me that his Civil War-era style band had
acquired a new and "fabulous" singer who was performing old ballads with
them, and that her voice was powerfull enough to break windows and that she
was a "professional trained opera singer!"   I wondered why she wasn't
singing opera then, as window glass was a valued commodity back in those
days and not something you'd want to go around breaking willy-nilly and
all.  Then again, he plays a classic c.1910 Fairbanks Whyte Laydie banjo
with a plastic head and steel strings for his "authentic Civil War music"
performances, so to each their own.  -I guess it's ALL got to be better
than William Shatner's "singing" the Beatles' Lucy in the Sky With Diamonds.
Lisa  "We consider that the man who can fiddle all through one of those
  Virginia reels without losing his grip, may be depended upon in any
  kind of emergency."   - Mark Twain
  - Letter to Virginia City Territorial Enterprise, January 1863

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Our Goodman (Jo Jo Adams)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 10:07:11 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(92 lines)


----- Original Message -----
From: Howard Rye <[unmask]>
Sent: Thursday, September 04, 2003 5:09 AM
Subject: Re: Our Goodman (Jo Jo Adams)on 2/9/03 19:50, Richard Shurman at [unmask] wrote:Also Cabbage Head parts 1 and 2 by Jo Jo Adams on Aristocrat.This is slightlly earlier than Powell's (July 1948), but obviously an
interesting comparison. I have transcribed it:Part 1Well, Monday night when I came home, just as high as I could be,
Well, I saw a hat hanging on the rack where my hat's supposed to be.
I said, "Wake up my wife, my beautiful wife, wake up and answer me,
Tell me whose old hat is that on that rack where my hat's supposed to be?"
She said, "Be shamed you fool, you drunken old fool, well honey can't you
see,
That ain't nothin' but a coffee-pot that your grandpa gave to me."
I said, "I've traveled this world for many a mile and I hope to travel some
more,
But I'll be darned if I ever saw a coffee-pot with a hat band round its
fore."Baby, what can the matter be?
Honey, what you tryin' to do to me?
Darlin', is you tryin' to put me down?
Tell me pretty baby, can't I really stick around?'Cos Tuesday and Wednesday, I got high again, just as high as I could be,
Well, I saw some feet stickin' in the shoes where my feet's supposed to be.
I said, "Wake up my wife, my beautiful wife, wake up and answer me,
Tell me whose old feet is that in them shoes where my feet's supposed to
be?"
She said, "Now you just be shamed you drunken old fool, well honey can't you
see,
That ain't nothin' but an empty pair of shoes that your grandma gave to me."
I said, "Well now listen, I been around this world many times and I hope to
go some more,
But I'll be darned if I ever saw an empty pair of shoes with feet stickin'
in 'em before."Tell me baby, honey what you tryin' to do to me?
Baby, is you tryin' to let me be?
Honey, please don't put me down.
Tell me, pretty baby, that you'll let me stick around.Part 2That night I got high again, just as high as I could be,
Well, then I saw a head layin' in the bed where my head is supposed to be.
I said, "Wake up my wife, my beautiful wife, wake up and answer me,
Tell me whose old head is that in that bed where my head's supposed to be?"
She said, " "Be shamed you fool, you drunken old fool, now honey can't you
see,
That ain't nothin' but a cabbage head that your grandma gave to me."
I said, "I've traveled this world for many miles and I hope to travel some
more,
But I'll be dogged if I ever saw a cabbage head with hair growin' on it
before."Baby, honey, is you tryin' to put me down?
Tell me, tell me, can't I stick around?
Baby, is you trying to let me be?
Tell me pretty baby that you really love me.'Cos Saturday night, I got paid, got just as high as I could be.
Well,  I saw a thing in the thing where my thing's supposed to be.
I said, "Wake up my wife, my beautiful wife, wake up and answer me,
Tell me whose old thing is that in that thing where my thing is supposed to
be?"
"Be shamed you fool,  you drunken old fool, well honey can't you see,
That ain't nothin' but a rollin' pin that your grandpa made for me."
I said, "I've traveled this world for many miles and I hope to travel some
more,
But I'll be darned if I ever saw a rollin' pin with a voutee oreenee
before!"Cabbage Head, Parts 1 & 2, July 1948 (Aristocrat 803).Howard Rye
[unmask]
20 Coppermill Lane,
London,
E17 7HB
Tel/FAX: +44 20 8521 1098

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 10:11:30 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(18 lines)


----- Original Message -----
From: Fred McCormick <[unmask]><<By notes, I presume you're talking about record sleeve notes. In fact, the
piece echoes a passage in Folk Song in England, where Lloyd speculates on
the
antiquity of various ballads, principally The Outlandish Knight. It's all
very
tentaive, but you can find it in the chapter on The Big Ballads. Lloyd seems
to
be drawing most of his ideas from the Hungarian, Lajos Vargyas>>Yes, these were the notes from the album "First Person" (Topic, 1966), for
his Australian version of the song, "Shickered as He Could Be". A lot of the
notes on that LP seem to be recycled from "Folk Song in England".Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Our Goodman (Jo Jo Adams)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 10:14:06 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


----- Original Message -----
From: Andy <[unmask]>
Sent: Thursday, September 04, 2003 6:47 AM
Subject: Re: Our Goodman (Jo Jo Adams)Howard,> But I'll be darned if I ever saw a rollin' pin with a voutee oreenee
before!"   Is a 'voutee oreenee' what I think it is?   Andy Cohen

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Fw: Child Recordings
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 10:16:09 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


----- Original Message -----
From: <[unmask]>In a message dated 09/03/03 11:23:06 PM, Ed Craywrites:>Folks:
>
>There have been recordings by classical singers attempting what is now
>
>called "crossover" who sang the "Scarlet Town" variant of "Barbara Allen"
>
>(Child 84).  One shudders --
*******************************
And don't forget Lawrence Tibbett's dreadful rendition of "Edward."Sam Hinton
La Jolla, CA

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Our Goodman (Jo Jo Adams)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 10:34:12 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(30 lines)


----- Original Message -----
From: Howard Rye <[unmask]>
Sent: Thursday, September 04, 2003 9:11 AM
Subject: Re: Our Goodman (Jo Jo Adams)on 4/9/03 12:47, Andy at [unmask] wrote:Howard,> But I'll be darned if I ever saw a rollin' pin with a voutee oreenee
before!"  Is a 'voutee oreenee' what I think it is?  Andy CohenThese are syllables from Slim Gaillard's nonsense language, vout, and I
think they mean whatever the speaker and listener want them to mean!Around 1946 Gaillard published a Dictionary Of Vout which he claimed to have
distributed to colleges. It seems to be curiously rare and I have never seen
it.Howard Rye
[unmask]
20 Coppermill Lane,
London,
E17 7HB
Tel/FAX: +44 20 8521 1098

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: formally trained singers of trad song
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 10:44:30 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


----- Original Message -----
From: cwolfe <[unmask]>
Sent: Thursday, September 04, 2003 10:25 AM
Subject: formally trained singers of trad songThe most notorious example was Kentuckian Buell Kazee, whohad extensive
voice
lessons and deliberately went into his root dialect to makehis records for
Brunswick.Rebecca Tarwater, from Rockwood, Tennessee, came from a family of fully
traditional singers, and was so when she and her sister recorded for LCV.
Rebecca later married a wealthy businessman and moved to New York, where she
did get formal voice training. (I think she still is there today)Charles Wolfe

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Child Recordings
From: Scott Utley <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 12:08:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(61 lines)


My father, Francis Utley used to start the Barbara Allen with Jo Stafford
then Burl Ives then Rebecca Tarwater from the 78 collection of AAFSI
Leading the audience to traditional.
I am having trouble finding people to register as exhibitor at AFS
Albequerque
I have lots of good books. Salute to Dolores Nichols and bookfinder.[unmask]----- Original Message -----
From: "Lisa - S. H." <[unmask]>
To: <[unmask]>
Sent: Thursday, September 04, 2003 9:47 AM
Subject: Re: Child Recordings> At 01:08 AM 9/4/03 -0500, you wrote:
>
> >I've heard some of them, not only on "Barbara Allen" but other Child
> >ballads. I didn't shudder; I screamed. And dove for the radio dial.
> >
> >Peace,
> >Paul
>
>
> Sometimes, however, if the guilty singer sites a specific reference that
> they based their rendition on, and if that version has an interesting
> melody variation or verse, then that can lead one to investigate that
> source further and discover some nice versions to study.  A couple of
years
> ago I heard Custer LaRue's (she's more known for recording with the
> Baltimore Consort) "Appalachian" version of The Wife of Usher's Well, and
> found I liked a particular way the melody turned, despite inwardly
cringing
> at her classical (and lovely) voice attempting 1915 versions of ballads
> from the southern mountains, Virginia and Kentucky, etc.   She cited Cecil
> Sharpe's Southern Appalachian source book and (after recovering) I then
> wound up reading through all the various versions he had written down, and
> finding some nice things in there because of it.  I then learned a
> different version to sing that I liked better than the one I had been
> singing.  I guess that's something good.
> A musical friend recently told me that his Civil War-era style band had
> acquired a new and "fabulous" singer who was performing old ballads with
> them, and that her voice was powerfull enough to break windows and that
she
> was a "professional trained opera singer!"   I wondered why she wasn't
> singing opera then, as window glass was a valued commodity back in those
> days and not something you'd want to go around breaking willy-nilly and
> all.  Then again, he plays a classic c.1910 Fairbanks Whyte Laydie banjo
> with a plastic head and steel strings for his "authentic Civil War music"
> performances, so to each their own.  -I guess it's ALL got to be better
> than William Shatner's "singing" the Beatles' Lucy in the Sky With
Diamonds.
> Lisa
>
>
>
>   "We consider that the man who can fiddle all through one of those
>   Virginia reels without losing his grip, may be depended upon in any
>   kind of emergency."   - Mark Twain
>   - Letter to Virginia City Territorial Enterprise, January 1863

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 12:49:48 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(35 lines) , text/html(28 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 13:01:34 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(26 lines) , text/html(21 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Fw: Child Recordings
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 13:08:04 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(24 lines) , text/html(19 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Fw: Child Recordings
From: "Robert B. Waltz" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 12:46:05 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(32 lines)


On 9/4/03, Paul Stamler wrote:>----- Original Message -----
>From: <[unmask]>
>
>
>
>In a message dated 09/03/03 11:23:06 PM, Ed Craywrites:
>
>>Folks:
>>
>>There have been recordings by classical singers attempting what is now
>>
>>called "crossover" who sang the "Scarlet Town" variant of "Barbara Allen"
>>
>>(Child 84).  One shudders --
>*******************************
>And don't forget Lawrence Tibbett's dreadful rendition of "Edward."I find myself automatically wondering -- what are you people
DOING that you listen to all these things? :-)But there is a flip side of this. Someone mentioned Buell Kazee.
What about Vernon Dalhart -- he actually caused songs to *become*
traditional. In large numbers.--
Bob Waltz
[unmask]"The one thing we learn from history --
   is that no one ever learns from history."

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 11:57:04 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Paul:Now how is it that a Yiddish word for "drunk," "shickered," has become Australian slang?  Early globilization?Ed
----- Original Message -----
From: Paul Stamler <[unmask]>
Date: Thursday, September 4, 2003 8:11 am
Subject: Re: Our Goodman> ----- Original Message -----
> From: Fred McCormick <[unmask]>
>
> <<By notes, I presume you're talking about record sleeve notes. In fact, the
> piece echoes a passage in Folk Song in England, where Lloyd speculates on
> the
> antiquity of various ballads, principally The Outlandish Knight. It's all
> very
> tentaive, but you can find it in the chapter on The Big Ballads. Lloyd seems
> to
> be drawing most of his ideas from the Hungarian, Lajos Vargyas>>
>
> Yes, these were the notes from the album "First Person" (Topic, 1966), for
> his Australian version of the song, "Shickered as He Could Be". A lot of the
> notes on that LP seem to be recycled from "Folk Song in England".
>
> Peace,
> Paul
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Fw: Child Recordings
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 11:59:45 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


> ----- Original Message -----> And don't forget Lawrence Tibbett's dreadful rendition of "Edward."
>
> Sam Hinton
> La Jolla, CA
>Sam:  I have spent six decades trying to forget that, and you have to bring it up.  Which brings us to the Alfred Deller Consort on Vanguard (which should have known better).Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Fw: Child Recordings
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 15:35:56 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


Robert B. Waltz wrote:
>
>
> I find myself automatically wondering -- what are you people
> DOING that you listen to all these things? :-)
>Why can't I say that without getting into trouble.Bruce Olson

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re Our Goodman
From: Ewan McVicar <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 4 Sep 2003 19:36:36 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


Somewhere not to hand I have an EP by Sonny Boy Williamson [the Second SBW
I think] with an energetic  blues version of this ballad. If I can locate
it I will post the lyrics.EwanEwan McVicar,
84 High Street
Linlithgow,
West Lothian
Scotland
EH49 7AQtel 01506 847935

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 00:05:10 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(15 lines)


----- Original Message -----
From: edward cray <[unmask]><<Now how is it that a Yiddish word for "drunk," "shickered," has become
Australian slang?  Early globilization?>>I once heard it suggested, perhaps by Lloyd (or was it in Robert MacNeil's
book on the English language? Don't remember now) that there was an
emigration of Russian Jews to Australia in the late 19th-early 20th century,
around the time when life for them under the tsar was becoming intolerable.
Much smaller than the emigration to America, but enough to have brought the
word.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Fw: Child Recordings
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 00:07:43 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


----- Original Message -----
From: edward cray <[unmask]>
-----> And don't forget Lawrence Tibbett's dreadful rendition of "Edward."
>
> Sam Hinton
> La Jolla, CA<<Sam:  I have spent six decades trying to forget that, and you have to
bring it up.  Which brings us to the Alfred Deller Consort on Vanguard
(which should have known better).>>I can picture Seymour Solomon and Maynard Solomon having a long argument
about that, with sales figures finally trumping artistic merit. They
released quite a few of those dreadful things.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 00:24:29 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


----- Original Message -----
From: Ewan McVicar <[unmask]><<Somewhere not to hand I have an EP by Sonny Boy Williamson [the Second SBW
I think] with an energetic  blues version of this ballad. If I can locate
it I will post the lyrics.>>"Wake Up Baby" (Checker 894, 1958)If you find it, I do look forward to those lyrics.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 09:35:47 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


>> Now how is it that a Yiddish word for "drunk," "shickered," has
>> become Australian slang?  Early globilization?
> I once heard it suggested, perhaps by Lloyd (or was it in Robert
> MacNeil's book on the English language? Don't remember now) that
> there was an emigration of Russian Jews to Australia in the late
> 19th-early 20th century, around the time when life for them under
> the tsar was becoming intolerable.  Much smaller than the emigration
> to America, but enough to have brought the word.Sidney Baker, in "The Australian Language", suggests it comes from
a now-defunct word for beer, "she-oak", which he gives no etymology
for.  He gives a cite from 1886 for its use in "she-oak net", a
safety net strung under the gangways of ships at the quayside in
Melbourne to catch falling drunks.  Could "she-oak" itself be another
form of the same Yiddish root?1886 seems a bit early for Jewish immigration to Australia to have
got a word into the language but it might just have been possible.Jews in Australia assimilated faster than in the US so there was less
chance for Yiddish words to get into circulation, but even so there
don't seem to be enough of them cited in Baker's book - perhaps he
didn't have enough information about Yiddish to spot them.-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 05:08:30 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(39 lines) , text/html(34 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 05:10:26 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(24 lines) , text/html(22 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 08:47:23 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


The humour and verse form of "Our Goodman" invites revisions and/or
extension, and there will probably never be an end to them.
There's a long history of doing such.At Child, ESPB, at "Our Goodman" in his Appendix is such a version
commencing "'Twas on Chrismas day", from a slip song of c 1805.That one's by Samuel Arnold, Jr, and was first sung on July 26,
1794, to the tune of "My Daddy's a Delver of Dykes/ The Mucking
of Geordies Byar". It's in Samuel Arnold's 'Auld Robin Gray'.That was three years before Herd's text appeared with a tune from
a traditional singer in 'The Scots Musical Museum', #454, 1797.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 10:10:08 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(38 lines)


Bruce Olson wrote:
>
> The humour and verse form of "Our Goodman" invites revisions and/or
> extension, and there will probably never be an end to them.
> There's a long history of doing such.
>
> At Child, ESPB, at "Our Goodman" in his Appendix is such a version
> commencing "'Twas on Chrismas day", from a slip song of c 1805.
>
> That one's by Samuel Arnold, Jr, and was first sung on July 26,
> 1794, to the tune of "My Daddy's a Delver of Dykes/ The Mucking
> of Geordies Byar". It's in Samuel Arnold's 'Auld Robin Gray'.
>
> That was three years before Herd's text appeared with a tune from
> a traditional singer in 'The Scots Musical Museum', #454, 1797.
>
> Bruce Olson
>
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> subject index) </a>I get smart late.The info above was gathered bit by bit over a period of years,
from a number of books.One can get most of it in a few minutes by searching for 'Twas on
Christmas Day" in EASMES on its website.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Fw: Child Recordings
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 10:35:29 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(35 lines)


Paul Stamler wrote:
>
> ----- Original Message -----
> From: edward cray <[unmask]>
> -----
>
> > And don't forget Lawrence Tibbett's dreadful rendition of "Edward."
> >
> > Sam Hinton
> > La Jolla, CA
>
> <<Sam:  I have spent six decades trying to forget that, and you have to
> bring it up.  Which brings us to the Alfred Deller Consort on Vanguard
> (which should have known better).>>
>
> I can picture Seymour Solomon and Maynard Solomon having a long argument
> about that, with sales figures finally trumping artistic merit. They
> released quite a few of those dreadful things.
>
> Peace,
> PaulI was once shocked when a Scots descent friend of mine came back came
back from a vist to Scotland and described a evening of entertainment in
which there were several dramatic readings of old Scots ballads. He was
a bit surprised, and probably doubtful, when I told him that some people
sing them.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 08:03:01 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(44 lines)


Folks:This pleasant exchange underscores an argument I have long made (to the deaf ears of the folk song revivalists) that one cannot truly study folk song in isolation from folklore in general.Ed----- Original Message -----
From: Jack Campin <[unmask]>
Date: Friday, September 5, 2003 1:35 am
Subject: Re: Our Goodman> >> Now how is it that a Yiddish word for "drunk," "shickered," has
> >> become Australian slang?  Early globilization?
> > I once heard it suggested, perhaps by Lloyd (or was it in Robert
> > MacNeil's book on the English language? Don't remember now) that
> > there was an emigration of Russian Jews to Australia in the late
> > 19th-early 20th century, around the time when life for them under
> > the tsar was becoming intolerable.  Much smaller than the emigration
> > to America, but enough to have brought the word.
>
> Sidney Baker, in "The Australian Language", suggests it comes from
> a now-defunct word for beer, "she-oak", which he gives no etymology
> for.  He gives a cite from 1886 for its use in "she-oak net", a
> safety net strung under the gangways of ships at the quayside in
> Melbourne to catch falling drunks.  Could "she-oak" itself be another
> form of the same Yiddish root?
>
> 1886 seems a bit early for Jewish immigration to Australia to have
> got a word into the language but it might just have been possible.
>
> Jews in Australia assimilated faster than in the US so there was less
> chance for Yiddish words to get into circulation, but even so there
> don't seem to be enough of them cited in Baker's book - perhaps he
> didn't have enough information about Yiddish to spot them.
>
> ---------------------------------------------------------------------------
> --
> Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
> <" target="l">http://www.purr.demon.co.uk/jack>     *     food intolerance
> data & recipes,
> Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
> ---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <-
> --
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Our Goodman (Jo Jo Adams)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 10:20:12 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


----- Original Message -----
From: Dick Spottswood <[unmask]>
Sent: Friday, September 05, 2003 12:40 PM
Subject: Re: Our Goodman (Jo Jo Adams)Re: Our Goodman (Jo Jo Adams)"Voutee Orenne" was a scat phrase circulated by
the comic Slim Gaillard.  Looks like a pretty good version!I like "Old Man Crip," sung in English by the Jolly Boys of Lafayette (Decca
1937), wherein the drunken husband deals with "headlights on a baby
carriage, I never seen before."

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: BALLAD-L Digest - 4 Sep 2003 (#2003-53)
From: Dan Goodman <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 10:57:12 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


  > Date:    Thu, 4 Sep 2003 11:57:04 -0700
> From:    edward cray <[unmask]>
> Subject: Re: Our Goodman
>
> Paul:
>
> Now how is it that a Yiddish word for "drunk," "shickered," has become Australian slang?  Early globilization?Date:    Thu, 4 Sep 2003 11:57:04 -0700
From:    edward cray <[unmask]>
Subject: Re: Our GoodmanPaul:Now how is it that a Yiddish word for "drunk," "shickered," has become
Australian slang?  Early globilization? From http://www.sbs.com.au/radio/yiddish/community.htmlBack in 1788, it's believed 14 Jews were among the convicts on the First
Fleet which arrived in Botany Bay south of present-day Sydney. Yiddish
speakers began to arrive in greater numbers following the discovery of
gold in the 1850s.--
Dan Goodman
Journal http://dsgood.blogspot.com or
http://www.livejournal.com/users/dsgood/
Whatever you wish for me, may you have twice as much.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 12:03:28 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(61 lines) , text/html(72 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Our Goodman (Jo Jo Adams)
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 12:10:50 EDT
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


In a message dated 09/05/03 8:21:49 AM, [unmask] writes:>I like "Old Man Crip," sung in English by the Jolly Boys of Lafayette (Decca
>1937), wherein the drunken husband deals with "headlights on a baby
>carriage, I never seen before."
*******************************
There was a version that was made up in New York during the great Folksong
Boom of the 50s and 60's (The great Folksong Scare" , in the words of U. Utah
Phillips), in which the wife says that "a pair of pants" on the chair was
actually a "prayer shawl,"  but the suspicious husband had never seen a "prayer
shawl with a zipper!"Sam
La Jolla, CA

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 11:12:36 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(35 lines)


----- Original Message -----
From: Jack Campin <[unmask]>
To: <[unmask]>
Sent: Friday, September 05, 2003 3:35 AM
Subject: Re: Our Goodman>> Now how is it that a Yiddish word for "drunk," "shickered," has
>> become Australian slang?  Early globilization?<<Sidney Baker, in "The Australian Language", suggests it comes from
a now-defunct word for beer, "she-oak", which he gives no etymology
for.  He gives a cite from 1886 for its use in "she-oak net", a
safety net strung under the gangways of ships at the quayside in
Melbourne to catch falling drunks.  Could "she-oak" itself be another
form of the same Yiddish root?>>"She-oak" also shows up in another traditional Australian song, "The
Drover's Dream":"Then the parrots green and blue sang 'Bold Jack Donahue'
The frilly lizards waltzed 'round with a smile
'Til from out the old she-oak a laughing-jackass spoke
And spare me happy days, they run a mile"Sounds like a plant or a bush to me, not beer. A she-oak net could
conceivably be a net woven from the plant, and its use in catching drunks
may have led to its use to mean beer. But 'shickered' is such a direct
borrowing from Yiddish that I'd be inclined to say "she-oak" is a
coincidence, unrelated.All speculation of course.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Mary Cliff <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 12:17:24 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(45 lines)


What a great discussion.  It's like a seminar in slo-mo.  And i have no
credentials to jump in, but here goes...
If my library were computerized, i'd be able to find such things, but i'm
still trusting my feeble brain.  Some songs are probably hideous, but i
just listen to them with different ears.  8-)I deal with both classical and folk musics daily at WETA.   On the one
hand, i'm pleased when "art song" incorporates folk material; i think it's
a healthy thing and a recognition of a different kind of cultural
continuity than you usually find on the concert stage (except in the
African-American spiritual tradition)  Such things usually make me smile
-- for that cultural continuity thing -- and because the songs usually
sound as if they've been put in a straightjacket, which i find somewhat
amusing.  (i find a LOT of things amusing these days)  And the favor is
sometimes returned.  How many "folk" versions of Summertime have we heard?
 Buddy, Can You Spare a Dime?  Bantock's Song to the Seals -- okay, he
claimed to have adapted that from a folk context.This discussion reminded me of some of my favorites, and Dr. John is
playing in the background.  On his "Going Back to New Orleans" CD, he
includes a couple gems, all with roots (to his experience) in New Orleans.
 He refers to "Didn't He Ramble" as being a long-time song there, his
notes referring to "livin and dyin, gamblin and murder and whorin,
messed-up love affairs, real stuff," all either stated or implied in that
song.    So how, pray tell, did The Derby Ram morph into "Didn't He
Ramble?"  He credits the song to Hatty Bolton.And the song "Cabbage Head" is referred to as "more of a country story ...
country bumpkin lyrics."  Professor Longhair did it, Sonny Boy Williamson,
and Dr. John's own grandpa....   But wouldn't you know, in New Orleans of
all places, the whole pattern of DRUNK is gone.   "Last night i come home/
tired as a man can be..."  The mule is there, the hat, and some guy
(nothin but a shadow).  Dr. John shares the author's credit here with
Professor Longhair.It's been amazing to see how many performers from the pop world are "going
back" and recording roots songs, yes, including the old ballads.  But i
haven't heard a concert setting of "O Death" yet.   ooo, just the idea of
that hurts.I'll go back to lurking now.Mary Cliff, TRADITIONS
WETA Radio
Washington, DC

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 12:19:56 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(68 lines) , text/html(67 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Our Goodman (Jo Jo Adams)
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 12:30:31 EDT
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


In a message dated 09/05/03 8:21:49 AM, [unmask] writes:>I like "Old Man Crip," sung in English by the Jolly Boys of Lafayette (Decca
>1937), wherein the drunken husband deals with "headlights on a baby
>carriage, I never seen before."
*******************************
There was a version that was made up in New York during the great Folksong
Boom of the 50s and 60's (The great Folksong Scare" , in the words of U. Utah
Phillips), in which the wife says that "a pair of pants" on the chair was
actually a "prayer shawl,"  but the suspicious husband had never before seen a
"prayer shawl with a zipper!" ( I
think the song used the Yiddish or Hebrew word for a "prayer shawl,"  but I
can't remember it this morning"! )Sam
La Jolla, CA

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: BALLAD-L Digest - 4 Sep 2003 (#2003-53)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 13:39:28 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


----- Original Message -----
From: Dan Goodman <[unmask]><< From http://www.sbs.com.au/radio/yiddish/community.htmlBack in 1788, it's believed 14 Jews were among the convicts on the First
Fleet which arrived in Botany Bay south of present-day Sydney. Yiddish
speakers began to arrive in greater numbers following the discovery of
gold in the 1850s.>>I'd put my bet on the gold rush immigrants rather than the First Fleet
folks; they'd presumably have been English-, not Yiddish-speaking, as
Yiddish was mostly spoken by Central Eastern Europeans. Obvious exceptions,
of course, but that's what I'd bet.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 13:42:16 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


----- Original Message -----
From: Fred McCormick <[unmask]><<Curiously enough, nobody yet seems to have mentioned Coley Jones' version
of
Our Goodman, The Drunkard's Special, which he recorded in Dallas in 1929.>>I believe he was talked about in the very first posting, and we've ignored
him as old news since then.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Our Goodman (Jo Jo Adams)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 13:45:16 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


----- Original Message -----
From: <[unmask]>
To: <[unmask]>
Sent: Friday, September 05, 2003 11:30 AM
Subject: Re: Fw: Our Goodman (Jo Jo Adams)<<There was a version that was made up in New York during the great Folksong
Boom of the 50s and 60's (The great Folksong Scare" , in the words of U.
Utah
Phillips), in which the wife says that "a pair of pants" on the chair was
actually a "prayer shawl,"  but the suspicious husband had never before seen
a
"prayer shawl with a zipper!" ( I
think the song used the Yiddish or Hebrew word for a "prayer shawl,"  but I
can't remember it this morning"! )>>"Tallis", as in "Fantasia on a Theme of".Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Ebay List - 09/05/03
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 15:24:07 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(103 lines)


Hi!        As promised, here is the weekly list. It is quite long (may be 2
postings) and growing by the minute. For example, there were no
songsters two days and four have been listed in the last 24 hours.        SONGSTERS        2187941246 - The Coon Exterminator, or, Polk, Dallas, and Shunk
Songster, 1844, $50 (ends Sep-10-03 10:00:00 PDT) (live auction)        3549362306 - The Teddy Regan Songster, 1861, $6.01 (ends
Sep-11-03 09:06:20 PDT)        2556327903 - MCGINTY SONGSTER, 18??, $9.99 (ends Sep-11-03
14:15:30 PDT)        2190749076 - DUPREZ'S Famous Minstrels Songster, 1900?, $3 (ends
Sep-14-03 11:45:10 PDT)        2190750267 - FOREPAUGH'S SONGSTER, 1905?, $3 (ends Sep-14-03
11:51:02 PDT)        SONGBOOKS, ETC.        3548107952 - WHERE IS SAINT GEORGE? Pagan Imagery in English
Folksong by Stewart, 1988, $3 (ends Sep-06-03 18:22:52 PDT)        3548127532 - STEAMBOATIN' DAYS, Folk Songs of the River Packet
Era by Wheeler, 1944, $9.99 (ends Sep-06-03 20:34:08 PDT)        3239762133 - THE FENIAN SONG BOOK, 1940?, $9.99 (ends Sep-07-03
08:49:13 PDT)        3548313665 - Irish Street Ballads by O Lochlainn, 1965 printing,
$6 (ends Sep-07-03 12:59:33 PDT)        3548372013 - English Ballads by Johnson, 1894, $9.99 (ends
Sep-07-03 17:34:11 PDT)        3548377864 - Checklist of California Folk Songs Part One, Texts
in Print, 1940, $9 (ends Sep-07-03 18:00:42 PDT)        3548379201 - Many A Good Horseman Traditional Music Making in
Mid Suffolk by Howson, 1985, $9 (ends Sep-07-03 18:05:23 PDT)        3548384091 - Singing Island; a collection of English and Scots
Folksongs by MacColl & Seeger, 1960, $9 (ends Sep-07-03 18:26:12 PDT)        3548389266 - Rowlock Rhymes and Songs of Exile by "North
Antrim", edited by Sam Henry, 1933, $12, (ends Sep-07-03 18:46:46 PDT)        3548392823 - The Convict Maid, Early Broadsides Relating to
Australia by Edwards, 1985, $9.99 (ends Sep-07-03 19:01:23 PDT)        3548407959 - Cowboy Songs of the Open Range by Sires, 1928, $19
(ends Sep-07-03 20:07:18 PDT)        3548436676 - THE MINSTRELSY OF THE SCOTTISH HIGHLANDS by
Moffat, $10 AU, (ends Sep-08-03 00:46:54 PDT)        3548453831 - Ballads & Songs from Utah by Hubbard, 1961, $19
(ends Sep-08-03 04:37:21 PDT)        3548580227 - Singing Family of the Cumberlands by Ritchie, 1955,
$0.99 (ends Sep-08-03 14:37:33 PDT)        3548590401 - NEW GREEN MOUNTAIN SONGSTER TRADITIONAL FOLK SONGS
OF VERMONT by Flanders, Ballard, Brown & Brown, 1966 reprint, $4.99
(ends Sep-08-03 15:38:25 PDT)        2555661171 - NEGRO SONGS FROM ALABAMA by Courlander, 1963, $9.99
(ends nds Sep-09-03 19:58:46 PDT)        3240704268 - The Negro and His Folklore in Nineteenth-Century
Periodicals by Jackson, 1967, $4.99 (ends Sep-10-03 05:04:03 PDT)        2555684260 - Irish Com-All-Ye's and Ballads of Ireland, 1901, $5
(ends Sep-10-03 17:00:00 PDT)        3549266161 - The Folk Carol of England by Brice, 1967, $14 (ends
Sep-11-03 05:57:49 PDT)        3549277209 - Ballads and Sea Songs of Newfoundland by Greenleaf,
1968 reprint, $29 (ends Sep-11-03 06:23:02 PDT)        2555305536 - Folk Songs Of The Southern Appalachians by Ritchie,
1965, $5.99 (ends Sep-11-03 08:47:35 PDT)        2556386190 - Chantez Encore Folksongs Of French South Louisiana
by Gilmore, 1991, $7.50 (ends Sep-11-03 18:09:40 PDT)        That's it for now! I more items which close on 9/12-15 including
a complete Dover set of Child. These will be in the next list.                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Sameness of tunes
From: Steve Gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 14:52:10 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(9 lines)


Hi,
Ironically in view of the theme of the thread, Lannigan's Ball like many
songs in Tony Pastor's repertoire was from the repertoire of Harry Clifton
the British Music Hall artiste who wrote several songs which have been
collected as traditional. The writer of the words was in fact D.K. Gavan,
the Galway poet, who also wrote the words to The Rocky Road to Dublin.
Unfortunately who wrote the tunes is not as clear. If anyone wants furthe
info on Harry Clifton and his songs I have copies of most of his original
sheet music.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Convict-Exiles
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 14:08:01 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(5 lines)


Folks:Dan Goodman notes that the first shipment of convict-exiles to Australia included 14 Jews.  At least they had a minyan.Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Mary Cliff <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 5 Sep 2003 12:17:24 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(44 lines)


What a great discussion.  It's like a seminar in slo-mo.  And i have no
credentials to jump in, but here goes...
If my library were computerized, i'd be able to find such things, but i'm
still trusting my feeble brain.  Some songs are probably hideous, but i
just listen to them with different ears.  8-)I deal with both classical and folk musics daily at WETA.   On the one
hand, i'm pleased when "art song" incorporates folk material; i think it's
a healthy thing and a recognition of a different kind of cultural
continuity than you usually find on the concert stage (except in the
African-American spiritual tradition)  Such things usually make me smile
-- for that cultural continuity thing -- and because the songs usually
sound as if they've been put in a straightjacket, which i find somewhat
amusing.  (i find a LOT of things amusing these days)  And the favor is
sometimes returned.  How many "folk" versions of Summertime have we heard?
 Buddy, Can You Spare a Dime?  Bantock's Song to the Seals -- okay, he
claimed to have adapted that from a folk context.This discussion reminded me of some of my favorites. On Dr. John's "Going
Back to New Orleans" CD, he includes some gems, all with roots (to his
experience) in New Orleans.  He says "Didn't He Ramble" is long-time song
there, his notes referring to "livin and dyin, gamblin and murder and
whorin, messed-up love affairs, real stuff," all either stated or implied
in that song.    So how, pray tell, did The Derby Ram morph into "Didn't
He Ramble?"  He credits the song to Hatty Bolton.And the song "Cabbage Head" is referred to as "more of a country story ...
country bumpkin lyrics."  Professor Longhair did it, Sonny Boy Williamson,
and Dr. John's own grandpa....   But wouldn't you know, in New Orleans of
all places, the whole pattern of DRUNK is gone.   "Last night i come home/
tired as a man can be..."  The mule is there, the hat, and some guy
(nothin but a shadow).  Dr. John shares the author's credit here with
Professor Longhair.It's been amazing to see how many performers from the pop world are "going
back" and recording roots songs, yes, including the old ballads.  But i
haven't heard a concert setting of "O Death" yet.   ooo, just the idea of
that sets my teeth on edge.I'll go back to lurking now.Mary Cliff, TRADITIONS
WETA Radio
Washington, DC

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 6 Sep 2003 06:25:53 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(19 lines) , text/html(16 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Re Our Goodman
From: Fred McCormick <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 6 Sep 2003 10:11:42 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(27 lines) , text/html(26 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 6 Sep 2003 17:28:56 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


Steve Gardham wrote:
>
> Hi,
> Ironically in view of the theme of the thread, Lannigan's Ball like many
> songs in Tony Pastor's repertoire was from the repertoire of Harry Clifton
> the British Music Hall artiste who wrote several songs which have been
> collected as traditional. The writer of the words was in fact D.K. Gavan,
> the Galway poet, who also wrote the words to The Rocky Road to Dublin.
> Unfortunately who wrote the tunes is not as clear. If anyone wants furthe
> info on Harry Clifton and his songs I have copies of most of his original
> sheet music.When, how, and where are we going to find out what you've learned from
those song sheets?Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: steve gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 19:01:28 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(43 lines)


Hi,Bruce,
I hope to publish eventually, but at the moment I have lots of other
projects in the pipeline, mainly concerning broadside ballads and their
links with folk which I know from your marvellous website is your subject
too. At the moment I'm working on a manuscript book of ballads written out
by a young girl in 1877, hopefully for publication. Meanwhile I could post a
list of Harry Clifton's songs on the Indiana chatroom, or at least those
that have folk connections. I'm also very interested in those ballads which
were burlesqued in the early 19th c such as Lord Lovell & Villikins.
Cheers, Steve.
----- Original Message -----
From: "Bruce Olson" <[unmask]>
To: <[unmask]>
Sent: Saturday, September 06, 2003 10:28 PM
Subject: Re: Sameness of tunes> Steve Gardham wrote:
> >
> > Hi,
> > Ironically in view of the theme of the thread, Lannigan's Ball like many
> > songs in Tony Pastor's repertoire was from the repertoire of Harry
Clifton
> > the British Music Hall artiste who wrote several songs which have been
> > collected as traditional. The writer of the words was in fact D.K.
Gavan,
> > the Galway poet, who also wrote the words to The Rocky Road to Dublin.
> > Unfortunately who wrote the tunes is not as clear. If anyone wants
furthe
> > info on Harry Clifton and his songs I have copies of most of his
original
> > sheet music.
>
> When, how, and where are we going to find out what you've learned from
> those song sheets?
>
> Bruce Olson
>
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> subject index) </a>
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Sameness of tunes
From: Steve Gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 13:05:19 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(3 lines)


Talking of Irish poets does anyone know anything about D.K.Gavan, the
Galway poet, who is credited with Lannigans Ball and The Rocky Road to
Dublin on the Clifton sheet music?

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: John Greenway's dissertation
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 12:04:44 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


Ed and others:
Does anyone happen to have a copy of John Greenway's doctoral diss. on
protest songs?  (I don't need the book version that he published).
Apparently U Penn doesn't have any copies, because after he turned
conservative John went to the library and destroyed all the copies they had.
Anyone else ever get a copy?
Norm Cohen

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: John Greenway's dissertation
From: "Cohen, Ronald" <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 16:32:44 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


Norm: I am thinking that Kenny Goldstein might have had a copy, which might be in his papers, wherever they are. Kenny was a close friend of Greenway, even after his political transformation. Or ask Roger Abrahams if he knows anything. ron cohen-----Original Message-----
From:   Norm Cohen [mailto:[unmask]]
Sent:   Sun 9/7/2003 2:04 PM
To:     [unmask]
Cc:	
Subject:        John Greenway's dissertationEd and others:
Does anyone happen to have a copy of John Greenway's doctoral diss. on
protest songs?  (I don't need the book version that he published).
Apparently U Penn doesn't have any copies, because after he turned
conservative John went to the library and destroyed all the copies they had.
Anyone else ever get a copy?
Norm Cohen

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Tacoma Park news
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 18:33:29 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(32 lines)


New briefs, 7/09/03
Today, 11 AM to 6 PM was Tacoma Park Folk Festival, (northern
suburb of Washinton DC) and tidbits picked up there noted at * below.
More real folk than ever if you knew where to look. E. g.,
Joe Hickerson and his successor Peggy Bulmer, and members of the current
staff of Library of Congress Folklore Archive gave samples both from old
field recordings and theb staff  member's own talented rendictions of LC
material.*Joe Hickerson (ethnomusicologist, and c 35 year head of Library of
Congress Folklore Archive) told me today, for the 3rd time in 2
years that he would eventally join Ballad-L.
Ethnomusicologist Anne Dhu McLucas has joined Ballad-L, but is
off to Wales for a week or so.
*Mary Cliff was still a volunteer stage manager until about 5
minutes ago. We only reviewed a few recent things on Ballad-L,
and she lead me to believe I may not get booted off Ballad-L for
expressing some opinions that proved unpopular here.
*Carly Gewirtz (folklorist, once conn
ected to Norm Cohen in Los Angeles) is now a lurker here, because her
husband, Ballad-L member Dean Clamons has got her set up on a computer
at home.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: (no subject)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 18:47:15 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


New briefs, 7/09/03
Today, 11 AM to 6 PM was the Tacoma Park Folk Festival, (northern
suburb of Washinton DC) and tidbits picked up there noted at * below.
More real folk than ever if you knew where to look. E. g.,
Joe Hickerson and his successor Peggy Bulmer, and members of the current
staff of Library of Congress Folklore Archive gave samples both from old
field recordings and their own talented rendicions of LC material.*Joe Hickerson (ethnomusicologist, and c 35 year head of Library of
Congress Folklore Archive) told me today, for the 3rd time in 2
years that he would eventally join Ballad-L.
Ethnomusicologist Anne Dhu McLucas has joined Ballad-L, but is tied up
with other concerns at present.
*Mary Cliff was a volunteer stage manager until about 6PM (after I
left). We only reviewed a few recent things on Ballad-L,
and she lead me to believe I may not get booted off Ballad-L for
expressing some opinions that proved unpopular here.
*Carly Gewirtz (folklorist, once conected to Norm Cohen in Los
Angeles) is now a lurker here, because her husband, Ballad-L
member Dean Clamons, has got her set up on a computer at home.Missed you D&D Nichols. Juveniles turned up at the FSGW Open Sing last
Friday night, so I had to jettison my plans to sing "Marie
from Gippursland".Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Gossip
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 19:03:52 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


New briefs, 7/09/03
Today, 11 AM to 6 PM was Tacoma Park Folk Festival, (northern
suburb of Washinton DC) and tidbits picked up there are noted at *
below.
More real folk than ever there if you knew where to look. E. g.,
Joe Hickerson and his successor Peggy Bulmer, and members of the current
staff of Library of Congress Folklore Archive gave samples both from old
(some bordering on ancient) field recordings and their own talented
rendictions of LC material. [Carpenter collection prominantly mentioned,
but no recordered examples given. Julia Bishop gave cuirrent status
account of progress on restoring Carpenter coll'n disks on the JISC
ballad list, as some here have seen, In Carpenter are recorded versions
from singers in Greig-Duncan collection.]*Joe Hickerson (ethnomusicologist, and c 35 year head of Library of
Congress Folklore Archive) told me today, for the 3rd time in 2
years that he would eventally join Ballad-L.
Ethnomusicologist Anne Dhu McLucas has joined Ballad-L, but is
elsewhere committed at present.
*Mary Cliff was still a volunteer stage manager until I left.
We only reviewed a few recent things on Ballad-L, and she lead me to
believe I may not get booted off Ballad-L for expressing some opinions
that proved unpopular here.
*Carly Gewirtz (folklorist, once connected to Norm Cohen in Los
Angeles) is now a lurker here, because her husband, Ballad-L
member Dean Clamons has got her set up on a computer at home.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tacoma Park news with a wee correction
From: Nancy-Jean Seigel <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 19:04:52 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(10 lines) , text/html(7 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 19:22:36 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


steve gardham wrote:
>
> ... At the moment I'm working on a manuscript book of ballads written out
> by a young girl in 1877, hopefully for publication. Meanwhile I could post a
> list of Harry Clifton's songs on the Indiana chatroom, or at least those
> that have folk connections. I'm also very interested in those ballads which
> were burlesqued in the early 19th c such as Lord Lovell & Villikins.
> Cheers, Steve.I know nothing about the about the origins of "Lord Lovel". I recently
saw commentary on 'Villikens' that shattered all that I though I knew
about it.>
> > > collected as traditional. The writer of the words was in fact D.K.
> Gavan,
> > > the Galway poet, who also wrote the words to The Rocky Road to Dublin.
> > > Unfortunately who wrote the tunes is not as clear. If anyone wants
> furthe
> > > info on Harry Clifton and his songs I have copies of most of his
> original
> > > sheet music.
> >All completely new info to me, and beyond what I thought I knew.
Blessings, and please tell us more.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: (no subject)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 19:42:42 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(13 lines)


Bruce Olson wrote:
>
> New briefs, 7/09/03Groan, I don't know where my final version of a proofread and extended
version of my post above disappeared. Since the posted one isn't totally
garbled, I guess I' better let it stand as is (The Irish have a Gaelic
tune title that boils down to "Let it be".
Of two additions, I now remember only that I missed seeing our list
members D&D Nichols.Bruce Olson

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 16:52:50 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(55 lines)


Steve:Post away.  And if you are looking for a permanent archive for your papers, let me know.  A small group of us are working towards an online folksong journal.Ed----- Original Message -----
From: steve gardham <[unmask]>
Date: Sunday, September 7, 2003 11:01 am
Subject: Re: Sameness of tunes> Hi,Bruce,
> I hope to publish eventually, but at the moment I have lots of other
> projects in the pipeline, mainly concerning broadside ballads and their
> links with folk which I know from your marvellous website is your subject
> too. At the moment I'm working on a manuscript book of ballads written out
> by a young girl in 1877, hopefully for publication. Meanwhile I could post a
> list of Harry Clifton's songs on the Indiana chatroom, or at least those
> that have folk connections. I'm also very interested in those ballads which
> were burlesqued in the early 19th c such as Lord Lovell & Villikins.
> Cheers, Steve.
> ----- Original Message -----
> From: "Bruce Olson" <[unmask]>
> To: <[unmask]>
> Sent: Saturday, September 06, 2003 10:28 PM
> Subject: Re: Sameness of tunes
>
>
> > Steve Gardham wrote:
> > >
> > > Hi,
> > > Ironically in view of the theme of the thread, Lannigan's Ball like many
> > > songs in Tony Pastor's repertoire was from the repertoire of Harry
> Clifton
> > > the British Music Hall artiste who wrote several songs which have been
> > > collected as traditional. The writer of the words was in fact D.K.
> Gavan,
> > > the Galway poet, who also wrote the words to The Rocky Road to Dublin.
> > > Unfortunately who wrote the tunes is not as clear. If anyone wants
> furthe
> > > info on Harry Clifton and his songs I have copies of most of his
> original
> > > sheet music.
> >
> > When, how, and where are we going to find out what you've learned from
> > those song sheets?
> >
> > Bruce Olson
> >
> > Roots of Folk: Old British Isles popular and folk songs, tunes,
> > and broadside ballads at my no-spam website
> > http://www.erols.com/olsonw"> Click here for homepage (=
> > subject index)
> >
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: John Greenway's dissertation
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 17:00:57 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(36 lines)


Norm:I didn't know that John "disowned" his thesis so severely that he pirated the library copy.  (Or is it a legend?)  After all, he did publish it as _American Folksongs of Protest._  Hard to sieze all the copies in print.I wonder if Eleanor Long had a copyof the thesis.  I am pretty sure that D.K. did and that Eleanor inherited it.  If not, then Alan Dundes might.  And try the Archive of Folk Culture.EdP.S.  Note how Wilgus takes Greenway apart on pp. 229-232 of _Anglo-American Folksong Scholarship._----- Original Message -----
From: "Cohen, Ronald" <[unmask]>
Date: Sunday, September 7, 2003 2:32 pm
Subject: Re: John Greenway's dissertation> Norm: I am thinking that Kenny Goldstein might have had a copy, which
> might be in his papers, wherever they are. Kenny was a close friend of
> Greenway, even after his political transformation. Or ask Roger Abrahams
> if he knows anything. ron cohen
>
>
> -----Original Message-----
> From:   Norm Cohen [[unmask]]
> Sent:   Sun 9/7/2003 2:04 PM
> To:     [unmask]
> Cc:
> Subject:        John Greenway's dissertation
>
> Ed and others:
> Does anyone happen to have a copy of John Greenway's doctoral diss. on
> protest songs?  (I don't need the book version that he published).
> Apparently U Penn doesn't have any copies, because after he turned
> conservative John went to the library and destroyed all the copies they had.
> Anyone else ever get a copy?
> Norm Cohen
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tacoma Park news
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 17:03:51 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(47 lines)


List Mother:Bruce's message reminds me I wanted to suggest that we publish the names of the ballad-l subscribers.Those lurkers wishing anonymity could opt out.  Just like we do for the bankjs, insurance companies and telephone solicitors.Ed----- Original Message -----
From: Bruce Olson <[unmask]>
Date: Sunday, September 7, 2003 3:33 pm
Subject: Tacoma Park news> New briefs, 7/09/03
> Today, 11 AM to 6 PM was Tacoma Park Folk Festival, (northern
> suburb of Washinton DC) and tidbits picked up there noted at * below.
> More real folk than ever if you knew where to look. E. g.,
> Joe Hickerson and his successor Peggy Bulmer, and members of the current
> staff of Library of Congress Folklore Archive gave samples both from old
> field recordings and theb staff  member's own talented rendictions of LC
> material.
>
> *Joe Hickerson (ethnomusicologist, and c 35 year head of Library of
> Congress Folklore Archive) told me today, for the 3rd time in 2
> years that he would eventally join Ballad-L.
> Ethnomusicologist Anne Dhu McLucas has joined Ballad-L, but is
> off to Wales for a week or so.
> *Mary Cliff was still a volunteer stage manager until about 5
> minutes ago. We only reviewed a few recent things on Ballad-L,
> and she lead me to believe I may not get booted off Ballad-L for
> expressing some opinions that proved unpopular here.
> *Carly Gewirtz (folklorist, once conn
> ected to Norm Cohen in Los Angeles) is now a lurker here, because her
> husband, Ballad-L member Dean Clamons has got her set up on a computer
> at home.
>
>
>
> Bruce Olson
>
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> http://www.erols.com/olsonw"> Click here for homepage (=
> subject index)
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tacoma Park news with a wee correction
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 20:24:10 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


Nancy-Jean Seigel wrote:
>
> For anyone who was confused, that was Peggy Bulger from the American
> Folklife Center.  A slip of the Bruce's finger and it came out
> "Bulmer".
>
> We know who you are Peggy.  The rest of you should have been there
> when she led the audience in "Now the meeting is over". The roof of
> the gym nearly blew off.
>
> Nancy-Jean SeigelThanks for the corrction Nancy-Jean. The name was in the Program which I
lost before I got home.Bruce Olson

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tacoma Park news
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 21:16:36 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


edward cray wrote:
>
> List Mother:
>
> Bruce's message reminds me I wanted to suggest that we publish the names of the ballad-l subscribers.
>
> Those lurkers wishing anonymity could opt out.  Just like we do for
> the bankjs, insurance companies and telephone solicitors>Opting out complicates things.I thought the present system on LISTSERV (no list of subscribers, as on
our old majordomo server) awkward at first, but I've changed my mind. We
get poster's email addresses on their postings here. Lurkers can't post
here annonymously, and may have valid reasons why they don't want their
e-mail address known generally known. I'd like to know who all the
lurkers are, but that doesn't seem to me to be as important as
protecting them for whatever the reason they want to be lurkers. The
resent status doesn't cause the posters any difficulty that I can see.Whether sound or ridiculous, I take my postings here to be readily
available to anyone who wants to look at them.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Lurkers
From: Jon Bartlett <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 21:13:39 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


I take great pleasure in reading all the posts, and when I have something to
contribute, I'll write (the same as I do to the papers and magazines I
subscribe to).  I have no problem with publishing the list - I seem to
remember that when I joined I had access to it.However...I would greatly appreciate replacing the vile word "lurker" with something
gentler - howzabout "reader"?Jon Bartlett

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: John Greenway's dissertation
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sun, 7 Sep 2003 21:32:22 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(63 lines)


Thanks, Ed and Ron, for the suggestions.  I don't think Kenny G. had a copy
because Archie Green had tried to find a copy also and it was Kenny who told
him about the removal of the library copies.
For those of you interested, my reason for seeking the diss. is as follows.
In doing some cursory research on the song "The Lowell Factory Girl" I found
that Greenway's printing of the ballad in his book seems to have been a
seminal source for most later singers.  John credited a broadside in the
Brown U. library as the source for his text.  However, there is no such.  I
was hoping that the dissertation might have had some more accurate
information on the source of this text.  Either John forgot where he saw the
broadside or (as Archie suggests) he took liberties with the text.
Any thoughts?
Norm
----- Original Message -----
From: "edward cray" <[unmask]>
To: <[unmask]>
Sent: Sunday, September 07, 2003 5:00 PM
Subject: Re: John Greenway's dissertation> Norm:
>
> I didn't know that John "disowned" his thesis so severely that he pirated
the library copy.  (Or is it a legend?)  After all, he did publish it as
_American Folksongs of Protest._  Hard to sieze all the copies in print.
>
> I wonder if Eleanor Long had a copyof the thesis.  I am pretty sure that
D.K. did and that Eleanor inherited it.  If not, then Alan Dundes might.
And try the Archive of Folk Culture.
>
> Ed
>
> P.S.  Note how Wilgus takes Greenway apart on pp. 229-232 of
_Anglo-American Folksong Scholarship._
>
> ----- Original Message -----
> From: "Cohen, Ronald" <[unmask]>
> Date: Sunday, September 7, 2003 2:32 pm
> Subject: Re: John Greenway's dissertation
>
> > Norm: I am thinking that Kenny Goldstein might have had a copy, which
> > might be in his papers, wherever they are. Kenny was a close friend of
> > Greenway, even after his political transformation. Or ask Roger Abrahams
> > if he knows anything. ron cohen
> >
> >
> > -----Original Message-----
> > From:   Norm Cohen [[unmask]]
> > Sent:   Sun 9/7/2003 2:04 PM
> > To:     [unmask]
> > Cc:
> > Subject:        John Greenway's dissertation
> >
> > Ed and others:
> > Does anyone happen to have a copy of John Greenway's doctoral diss. on
> > protest songs?  (I don't need the book version that he published).
> > Apparently U Penn doesn't have any copies, because after he turned
> > conservative John went to the library and destroyed all the copies they
had.
> > Anyone else ever get a copy?
> > Norm Cohen
> >
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Lurkers
From: Dave Eyre <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 08:13:09 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


I am more of a lurker ( for lurker I agree with Jon so read "reader") than
an erudite contributor, and enjoy the list for its erudition more than
anything else.Dave
[unmask]
www.collectorsfolk.co.ukFrom: "Jon Bartlett" <[unmask]>
To: <[unmask]>
Sent: Monday, September 08, 2003 5:13 AM
Subject: Re: Lurkers> I take great pleasure in reading all the posts, and when I have something
to
> contribute, I'll write (the same as I do to the papers and magazines I
> subscribe to).  I have no problem with publishing the list - I seem to
> remember that when I joined I had access to it.
>
> However...
>
> I would greatly appreciate replacing the vile word "lurker" with something
> gentler - howzabout "reader"?
>
> Jon Bartlett
>
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Our Goodman and 'shickered'
From: Jeffrey Kallen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 11:21:26 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(84 lines)


Dear folks,As a semi-lurker (I think 'lurker' is a kind of nice term -- gives one a
certain status with respect to the list; after all, everyone is a 'reader'
at one time or another), I've a couple supplementary points on Our Goodman
and 'shickered'.For anyone keeping track of blues/jazz versions of the song, the group
Martin, Bogan, and Armstrong did one which they called 'The Cabbage Song'.
I heard them sing it at the Smithsonian Folk Festival in about 1970 or 71
and at the University of Chicago in 1972 or 73. I don't remember all the
words, but their version included a blanket (with buttons on) and ended
with 'a cabbage head with a mustache on'. The chorus was roughlyI travelled this world over,
A thousand miles or more,
But a ___ with ___
I never saw beforeI don't know if this African-American trio ever recorded the song, but it
fit in nicely with their overall blues/jazz reprertoire.As for shickered, I think the 'she-oak' derivation is much too far-fetched.
'Globalisation' is exactly the right word, in that it seems plausible that
the word came from Europe to Australia at an early time. The question is,
how early and in what context?  G.A. Wilkes's *A Dictionary of Australian
Colloquialisms* (Sydney: Collins Australia, 1988) should be consulted
alongside *A Concise Dictionary of Slang and Unconventional English* (now
edited by Paul Beale, succeeding work started by Eric Partridge). Wilkes
lists "shickery" meaning 'shabby, badly' from 1859, but more to the point,
gives a quotation from Rolf Boldrewood's *An Australian Squire* (1878)
which supports a meaning more to the side of 'suffering the effects of
drink':"I'm always that fresh after a good night's sleep, when I've had a bit of a
spree that I could begin again quite flippant. Old Tom had a goodish cheque
this time, and was at it a week afore I came in. He was rayther shickerry."By 1898, Wilkes cites a source that simply defines the word "shiker" as
meaning 'drunk'. The citations continue up to 1973; I like this one:"A backbench senator referred today to the Jackson Pollock painting, 'Blue
Poles' bought by Australia for $1.3 million as 'shicker art' ... Later
outside the Senate he said that by 'shicker art' he meant paintings done by
people who were shickered, or drunk."But Australian usage also supports "shicker" as the word for liquor (oldest
citation 1916), and the verb "shicker" meaning 'to drink, get drunk'
(oldest citation 1913).Partridge/Beale cite "shicker" as 'drunk; from late 1890s' (that is, in
British usage). The example they cite, from Arther M. Binsted's *Gal's
Gossip* (1899), has an 'ethnic' flavour to it: "She comes over shikkur and
vants to go to shleeb". They also cite "shickery" as meaning 'shabby,
shabbily, bad, badly' as far back as 1851 and 'drunk' occasionally in the
late 19th and 20th centuries. The examples in Partridge's *Dictionary of
Historical Slang* (1972) are evidently British, and he makes no mention of
Australia. Beale, on the other hand, cites "shick" as Australian cince ca.
1920 for 'a drunken person', and gives "shick, shicked" meaning 'drunk' as
Australian, "shicker" meaning 'intoxicating liquor' and the phrase "on the
shicker" as in 'drinking heavily' as 'mostly Australian', and so on. Beale
(1989) cites a comment from 1971 to the effect that  'The East End Cockneys
got it from the early Jewish immigrants in the 80s of the last century'.
Leo Rosten's classic *The Joys of Yiddish* (now out in a new, updated
version called *The News Joys of Yiddish*, which I recommend) recognises
the Australian connection but is mystified by it.My guess is that the word came into Australian English not directly from
Yiddish, though it may have been reinforced by whatever Yiddish-speakers
did arrive there in the 19th century, but from British slang which had
already picked up the word from Yiddish. This wouldn't be the first such
case: according to Partridge, "kosher" meaning 'fair, square' dates back in
East End London slang to ca. 1860. Similarly, "nosh", eating in various
contexts, is well established in British (and for that matter Irish)
English; Partridge comments 'if ex German, it comes via Yiddish' (in
Ireland, we are not surprised to see restuarants with names like 'Posh
Nosh' -- and having a 'nosh-up' is a phrase with no conscious Yiddish
connotations at all). Whether other such Anglo-Yiddishisms were brought to
Australia I do not know, but this line of enquiry could go on forever ...Now back to lurking, or reading,Jeff Kallen

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 15:02:23 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


> Lannigan's Ball like many songs in Tony Pastor's repertoire was from
> the repertoire of Harry Clifton the British Music Hall artiste who
> wrote several songs which have been collected as traditional.  The
> writer of the words was in fact D.K. Gavan, the Galway poet, who also
> wrote the words to The Rocky Road to Dublin.  Unfortunately who wrote
> the tunes is not as clear.The tune for "Rocky Road to Dublin" is a slipjigified version of the
old Scots "Ay Waukin O".  No idea about Lannigan's Ball...-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman and 'shickered'
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 15:21:11 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


> "nosh", eating in various
> contexts, is well established in British (and for that matter Irish)
> English; Partridge comments 'if ex German, it comes via Yiddish' (in
> Ireland, we are not surprised to see restuarants with names like 'Posh
> Nosh' -- and having a 'nosh-up' is a phrase with no conscious Yiddish
> connotations at all).Interestingly multi-ethnic name given that "posh" is from Romany!I'm reminded of "Murphy's Pakora Bar" in Glasgow (next to the Ahmadiyya
mosque).-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Posh etymology
From: [unmask]
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 10:33:08 EDT
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(11 lines) , text/html(7 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman and 'shickered'
From: Ed Cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 08:22:48 -0700
Content-Type:TEXT/PLAIN
Parts/Attachments:

TEXT/PLAIN(9 lines)


Jeffrey:May I both compliment and thank you for the essay on "shickered" in
Australia. The Yiddish-to-Anglo/Irish-to-Oz theory makes sense to me.Thanks too for the bibliographical information.  I had no idea that both
Partridge and Rosten were updated.Ed

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 11:32:54 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


Jack Campin wrote:
>
> The tune for "Rocky Road to Dublin" is a slipjigified version of the
> old Scots "Ay Waukin O".  No idea about Lannigan's Ball...
>
>
> Jack Campin: ......."Ay Waukin O": I don't know how familiar the tune might be
to Americans. An ABC of the tune in 'The Scots Musical Museum', #213,
is given in the ABC file S1.ABC on my website. Wm. Stenhouse in
'Illustrations to SMM', #213, gave another version, also in S1.ABC
The earliest reported appearance of the tune is in Napier's
Scots Songs, shortly before its appearance in SMM, but I
haven't seen that.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Posh etymology
From: George Madaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 11:35:58 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


Likewise I was always told that POSH referred to the trip through the
Suez Canal to and from India Port Out  Starboard HomeGeorge
On Monday, September 8, 2003, at 10:33  AM, [unmask] wrote:> In a message dated 9/8/2003 9:21:48 AM Central Standard Time,
> [unmask] writes:
>
> Interestingly multi-ethnic name given that "posh" is from Romany!
>
>
>
> That's interesting!  I had always heard that it was an acronym for
> Port Outward, Starboard Home  which were the most expensive cabins in
> the turn of the century luxery liners since they never got direct
> sun.  What does it mean in Romany? and how old is it?
George F. Madaus
Boisi Professor of Education and Public Policy
Senior Research Fellow
National Board on Educational Testing and Public Policy
Center for the Study of Testing Evaluation and Educational Policy
Carolyn A. and Peter S. Lynch School of Education
Boston College
Chestnut Hill MA 02467
[unmask]
617. 552.4521
617 552 8419 FAX

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Another Goodman (summary)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 10:38:54 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(70 lines)


----- Original Message -----
From: Howard Rye <[unmask]>
Sent: Monday, September 08, 2003 6:59 AM
Subject: Re: Another Goodman (summary)I  thought I'd have a go at summarizing the various contributions we have
had to this thread. If I've missed anything or anybody it wasn't
intentional, except that I have ignored the various reports of Child ballads
recorded by artists in the European composed music tradition which were
forwarded via Ballad-L.I'm not sure the items I have categorized as 'pop' really matter much
either. And I am very curious to know who Dave Evans's recording was aimed
at. There are lots of other versions of Barbara Allen whose intended
audience perhaps don't know what a Child ballad but whose performers
certainly do. The stuff below is in the main the kind of recording I was set
to wondering about.African-AmericanJo Jo Adams, Cabbage Head parts 1 and 2 (Aristocrat) [Richard Shurman,
transcribed by HR]Chris Powell and The Five Blue Flames: Last Saturday Night (14 April 1949,
Columbia 30162) [ transcribed by HR]Sonny Boy Williamson (Rice Miller), Wake Up Baby: (Chicago, March
1958,Checker 894) [Dave Sax; transcription from Frad McCormack]Professor Longhair, Cabbagehead:  House Party New Orleans Style: The Lost
Sessions 1971­1972 (Rounder CD2057). [Chris Smith]CARIBBEANBlinky and the Roadmasters from St. Croix (US Virgin Islands), fragment of
"Matty Groves" under the title of "Matty Gru": 'Crucian Scratch Band Music'
(Rounder 5047). [Paul Stamler, Chris Smith]COUNTRY/ROCKABILLY (?)Luke Gordon,  Mustache On The Cabbage Head: 1958/9 (Quincy 933), and early
80s (own World label) [Dave Sax]Wade Mainer, Four Nights Drunk: c. 1952 (Blue Ridge) [Jim Nelson]Earl Johnson & His Clodhoppers, Five Nights Drunk [Frank J. Dalton]Several recordings of "Black Jack David", based on "The Gypsie Laddie".
Cliff Carlisle and T Texas Tyler recorded this in the 30s and 40s, and
Warren Smith did so for Sun in 1956. [Eliot Williams]Dave Evans recorded "Barbara Allen" for Vetco Records around about 1979 [Jon
Weisberger].POPSimon & Garfunkel, Scarborough Fair (Child 2: The Elfin Knight) [Chris
Smith]
Dubliners, Seven Drunken Nights  [Dave Sax, Chris Smith] (c.1967?) (It's not
in the June 1967 Gramophone Popular Record Catalogue Master Edition, so was
issued later than that.)Howard Rye
[unmask]
20 Coppermill Lane,
London,
E17 7HB
Tel/FAX: +44 20 8521 1098

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fw: Another Goodman (summary)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 10:39:58 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(9 lines)


----- Original Message -----
From: Alan R. Young <[unmask]>
Sent: Monday, September 08, 2003 9:24 AM
Subject: RE: Another Goodman (summary)Add to the African American section:Coley Jones - Drunkard's Special (Dec 6, 1929; Columbia 14489-D)

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: new word enters lexicon!
From: Beth Brooks <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 11:01:42 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(7 lines)


I'm going to try to use "slipjigified" at least once in my daily conversations from now on.>The tune for "Rocky Road to Dublin" is a slipjigified version of the
old Scots "Ay Waukin O".  No idea about Lannigan's Ball..Beth Brooks
Indianapolis

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Our Goodman and 'shickered'
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 11:03:13 -0500
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(31 lines) , text/html(42 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: John Roberts <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 12:10:31 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


Jack Campin said:
>
>The tune for "Rocky Road to Dublin" is a slipjigified version of the
>old Scots "Ay Waukin O".  No idea about Lannigan's Ball...
>After all the talk of tune families, am I the only one to say "Huh?"
But to extend the idea of family, I posit that they're both variants
of the Princess Royal.John Roberts.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 12:26:31 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(43 lines)


Bruce Olson wrote:
>
> Jack Campin wrote:
> >
> > The tune for "Rocky Road to Dublin" is a slipjigified version of the
> > old Scots "Ay Waukin O".  No idea about Lannigan's Ball...
> >
> >
> > Jack Campin: .......
>
> "Ay Waukin O": I don't know how familiar the tune might be
> to Americans. An ABC of the tune in 'The Scots Musical Museum', #213,
> is given in the ABC file S1.ABC on my website. Wm. Stenhouse in
> 'Illustrations to SMM', #213, gave another version, also in S1.ABC
> The earliest reported appearance of the tune is in Napier's
> Scots Songs, shortly before its appearance in SMM, but I
> haven't seen that.
>
> Bruce Olson
>Wm. Stenhouse in 'Illustrations to SMM', #213, said that the tune
"Ay Waukin O" in SMM 'is far from being genuine'. And he gives
the 'ancient air', but without saying how old 'ancient' was or
where he got his tune.There several Scots songs to the tune, from Napier's "Jess
Macpharlane" and Robet Burns' "Can I cease to care" to "The Licht
Bob's/ Lea-Boy's Lassie" in 'The Greig-Duncan Folk Song
Collection'.Stenhouse said the Joseph Ritson was of the opinion that the tune
was one of the oldest Scottish melodies.
This was probably from Ritson's 'Scottish Songs', 1794. I don't have
that work, and with prices for used copies starting at $270.00, I'm not
going to get it.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Another Goodman (summary)
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 13:33:35 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(91 lines)


As I mentioned earlier, Meade/Spottswood/Meade in "Country Music
Sources" has five pages of Child ballads recorded by country performers
from the 20s into the 40s. Won't attempt to list all the recordings but
the ballads identified are Child 7, 10, 12, 53, 68, 73, 79, 84, 85, 95,
155, 200, 243, 274, 278, 286, and 289.Also, to the African-American section you can add Blind Lemon
Jefferson's 1927 version of "Our Goodman" titled "Laboring Man Away From
Home." Oliver, in "Songsters & Saints," comments on the small number of
ballads performed by "black performers, many of them having entertained
white audiences." He goes on to say"Versions of 'The Maid Freed From The Gallows,' 'Lady Isabel and the Elf
Knight,' 'The Jew's Daughter' and 'Lord Lovel,' among other British
ballads, were collected in the first quarter of the century."Paul Stamler wrote:>----- Original Message -----
>From: Howard Rye <[unmask]>
>Sent: Monday, September 08, 2003 6:59 AM
>Subject: Re: Another Goodman (summary)
>
>
>I  thought I'd have a go at summarizing the various contributions we have
>had to this thread. If I've missed anything or anybody it wasn't
>intentional, except that I have ignored the various reports of Child ballads
>recorded by artists in the European composed music tradition which were
>forwarded via Ballad-L.
>
>I'm not sure the items I have categorized as 'pop' really matter much
>either. And I am very curious to know who Dave Evans's recording was aimed
>at. There are lots of other versions of Barbara Allen whose intended
>audience perhaps don't know what a Child ballad but whose performers
>certainly do. The stuff below is in the main the kind of recording I was set
>to wondering about.
>
>African-American
>
>Jo Jo Adams, Cabbage Head parts 1 and 2 (Aristocrat) [Richard Shurman,
>transcribed by HR]
>
>Chris Powell and The Five Blue Flames: Last Saturday Night (14 April 1949,
>Columbia 30162) [ transcribed by HR]
>
>Sonny Boy Williamson (Rice Miller), Wake Up Baby: (Chicago, March
>1958,Checker 894) [Dave Sax; transcription from Frad McCormack]
>
>Professor Longhair, Cabbagehead:  House Party New Orleans Style: The Lost
>Sessions 1971­1972 (Rounder CD2057). [Chris Smith]
>
>CARIBBEAN
>
>Blinky and the Roadmasters from St. Croix (US Virgin Islands), fragment of
>"Matty Groves" under the title of "Matty Gru": 'Crucian Scratch Band Music'
>(Rounder 5047). [Paul Stamler, Chris Smith]
>
>COUNTRY/ROCKABILLY (?)
>
>Luke Gordon,  Mustache On The Cabbage Head: 1958/9 (Quincy 933), and early
>80s (own World label) [Dave Sax]
>
>Wade Mainer, Four Nights Drunk: c. 1952 (Blue Ridge) [Jim Nelson]
>
>Earl Johnson & His Clodhoppers, Five Nights Drunk [Frank J. Dalton]
>
>Several recordings of "Black Jack David", based on "The Gypsie Laddie".
>Cliff Carlisle and T Texas Tyler recorded this in the 30s and 40s, and
>Warren Smith did so for Sun in 1956. [Eliot Williams]
>
>Dave Evans recorded "Barbara Allen" for Vetco Records around about 1979 [Jon
>Weisberger].
>
>POP
>
>Simon & Garfunkel, Scarborough Fair (Child 2: The Elfin Knight) [Chris
>Smith]
>Dubliners, Seven Drunken Nights  [Dave Sax, Chris Smith] (c.1967?) (It's not
>in the June 1967 Gramophone Popular Record Catalogue Master Edition, so was
>issued later than that.)
>
>
>Howard Rye
>[unmask]
>20 Coppermill Lane,
>London,
>E17 7HB
>Tel/FAX: +44 20 8521 1098
>
>
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Another Goodman (summary)
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 13:52:50 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(4 lines)


Slipping in my old age. There is an earlier African-American version
which escaped my notice."Cabbage Head Blues" by Lena & sylvester Kimbrough [mid 1926; Meritt 2201]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fw: Another Goodman (summary)
From: Clifford Ocheltree <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 13:53:08 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(4 lines)


Slipping in my old age. There is an earlier African-American version
which escaped my notice."Cabbage Head Blues" by Lena & Sylvester Kimbrough [mid 1926; Meritt 2201]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 15:16:10 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(25 lines)


John Roberts wrote:
>
>
> After all the talk of tune families, am I the only one to say "Huh?"
> But to extend the idea of family, I posit that they're both variants
> of the Princess Royal.
>
> John Roberts.Which one?Old pop: On the EASMES website are tunes called "Princess Royal", with
scale incipits/stressed note codes commencing://543/345, //13/17-,
//323/154,//17-1/6-32, and //11/123.Traditional: In JFSS2 to JFSS8 there are 4 tunes called "Princess
Royal", (stressed note coded in file COMBCOD3.TXT on my website),
as well as one called "Bold Princess Royal"Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: John Roberts <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 16:11:03 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(36 lines)


Not at all the Bold Princess Royal, but the setdance/morris/song tune
sometimes attributed to O'Carolan which appears in both major and
minor modes, and starts with a descending figure between 5 and 1,
which is about all the similarity _I_ see between Rocky Road to
Dublin and Ay Waukin O. Maybe I have the wrong tunes in my head, or
maybe your stress note code would reveal something I don't see.JR>John Roberts wrote:
>>
>>
>> After all the talk of tune families, am I the only one to say "Huh?"
>> But to extend the idea of family, I posit that they're both variants
>> of the Princess Royal.
>>
>> John Roberts.
>
>Which one?
>
>Old pop: On the EASMES website are tunes called "Princess Royal", with
>scale incipits/stressed note codes commencing://543/345, //13/17-,
>//323/154,//17-1/6-32, and //11/123.
>
>Traditional: In JFSS2 to JFSS8 there are 4 tunes called "Princess
>Royal", (stressed note coded in file COMBCOD3.TXT on my website),
>as well as one called "Bold Princess Royal"
>
>Bruce Olson
>
>Roots of Folk: Old British Isles popular and folk songs, tunes,
>and broadside ballads at my no-spam website
><A href="http://www.erols.com/olsonw"> Click here for homepage (=
>subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: John Greenway's dissertation
From: Jane Keefer <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 14:43:04 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(99 lines)


There is a microfilm copy at Washington University listed in
WorldCat.   I am not completely sure whether UPenn has their complete
holdings in WorldCat.You may be able to get this via ILLJane Keefer
Folk Music Index----- Original Message -----
From: Norm Cohen <[unmask]>
To: <[unmask]>
Sent: Sunday, September 07, 2003 9:32 PM
Subject: Re: John Greenway's dissertation> Thanks, Ed and Ron, for the suggestions.  I don't think Kenny G.
had a copy
> because Archie Green had tried to find a copy also and it was Kenny
who told
> him about the removal of the library copies.
> For those of you interested, my reason for seeking the diss. is as
follows.
> In doing some cursory research on the song "The Lowell Factory
Girl" I found
> that Greenway's printing of the ballad in his book seems to have
been a
> seminal source for most later singers.  John credited a broadside
in the
> Brown U. library as the source for his text.  However, there is no
such.  I
> was hoping that the dissertation might have had some more accurate
> information on the source of this text.  Either John forgot where
he saw the
> broadside or (as Archie suggests) he took liberties with the text.
> Any thoughts?
> Norm
> ----- Original Message -----
> From: "edward cray" <[unmask]>
> To: <[unmask]>
> Sent: Sunday, September 07, 2003 5:00 PM
> Subject: Re: John Greenway's dissertation
>
>
> > Norm:
> >
> > I didn't know that John "disowned" his thesis so severely that he
pirated
> the library copy.  (Or is it a legend?)  After all, he did publish
it as
> _American Folksongs of Protest._  Hard to sieze all the copies in
print.
> >
> > I wonder if Eleanor Long had a copyof the thesis.  I am pretty
sure that
> D.K. did and that Eleanor inherited it.  If not, then Alan Dundes
might.
> And try the Archive of Folk Culture.
> >
> > Ed
> >
> > P.S.  Note how Wilgus takes Greenway apart on pp. 229-232 of
> _Anglo-American Folksong Scholarship._
> >
> > ----- Original Message -----
> > From: "Cohen, Ronald" <[unmask]>
> > Date: Sunday, September 7, 2003 2:32 pm
> > Subject: Re: John Greenway's dissertation
> >
> > > Norm: I am thinking that Kenny Goldstein might have had a copy,
which
> > > might be in his papers, wherever they are. Kenny was a close
friend of
> > > Greenway, even after his political transformation. Or ask Roger
Abrahams
> > > if he knows anything. ron cohen
> > >
> > >
> > > -----Original Message-----
> > > From:   Norm Cohen [[unmask]]
> > > Sent:   Sun 9/7/2003 2:04 PM
> > > To:     [unmask]
> > > Cc:
> > > Subject:        John Greenway's dissertation
> > >
> > > Ed and others:
> > > Does anyone happen to have a copy of John Greenway's doctoral
diss. on
> > > protest songs?  (I don't need the book version that he
published).
> > > Apparently U Penn doesn't have any copies, because after he
turned
> > > conservative John went to the library and destroyed all the
copies they
> had.
> > > Anyone else ever get a copy?
> > > Norm Cohen
> > >
> >

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Lurkers
From: Carly Gewirz <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 18:02:54 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(53 lines)


Is that what I'm doing, lurking? I didn't mean to, honestly!  Seriously,  I
am a subscriber in my own name now, and I have no objection to my name being
available to other list subscribers. I have been enjoying the various
discussions immensely for the short time I've been  online, and  I  assume
that  if  I am ever in  possession of information useful to someone I will
pass it on. By the way, about that connection with Norm ... while a grad
student  in the folklore program at UCLA, I paid the rent, barely, by
working at the John Edwards Memorial Foundation, answering letters from
Japan about early bluegrass music and generally helping out  researchers. I
think I mentioned that to Bruce Olsen about  fifteen years ago...it is
positively frightening, what that man remembers!
Carly Gewirz
----- Original Message -----
From: "Dave Eyre" <[unmask]>
To: <[unmask]>
Sent: Monday, September 08, 2003 3:13 AM
Subject: Re: Lurkers> I am more of a lurker ( for lurker I agree with Jon so read "reader") than
> an erudite contributor, and enjoy the list for its erudition more than
> anything else.
>
> Dave
> [unmask]
> www.collectorsfolk.co.uk
>
>
>
>
> From: "Jon Bartlett" <[unmask]>
> To: <[unmask]>
> Sent: Monday, September 08, 2003 5:13 AM
> Subject: Re: Lurkers
>
>
> > I take great pleasure in reading all the posts, and when I have
something
> to
> > contribute, I'll write (the same as I do to the papers and magazines I
> > subscribe to).  I have no problem with publishing the list - I seem to
> > remember that when I joined I had access to it.
> >
> > However...
> >
> > I would greatly appreciate replacing the vile word "lurker" with
something
> > gentler - howzabout "reader"?
> >
> > Jon Bartlett
> >
> >
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Sameness of tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 20:52:56 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(36 lines)


John Roberts wrote:
>
> Not at all the Bold Princess Royal, but the setdance/morris/song tune
> sometimes attributed to O'Carolan which appears in both major and
> minor modes, and starts with a descending figure between 5 and 1,
> which is about all the similarity _I_ see between Rocky Road to
> Dublin and Ay Waukin O. Maybe I have the wrong tunes in my head, or
> maybe your stress note code would reveal something I don't see.
>
> JR
>5 variants of Carolan's "Princess Royal" are stressed note coded
in file COMBCOD3.TXT under cross reference # 626.
Duplicate copies of a tune from different sources I don't list
there, because that takes too much file space, and time to load
the file is already the slowest step in the search process.
In the Irish tune index on my website just search for
|626| for all known copies of all variants found prior to 1865.Tune coding is drudge work, and I lost interest after about 10
years of JFSS and didn't finish JFSS, and I have done none of JEFDSS,
FMJ, or Morris dance collections. I've only done Scots tunes to about
1735, and am even missing a few collections before that date. The
latter can, for the most part, be found in Charles Gore's 'The
Scottish Fiddle Music Index', but coded by a different system,
which sometimes does and sometimes doesn't match stressed notes in
my system or that used in EASMES.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Posh etymology
From: Alan Ackerman <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 18:44:00 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


>Likewise I was always told that POSH referred to the trip through the
>Suez Canal to and from India Port Out  Starboard Home
>
>George
>On Monday, September 8, 2003, at 10:33  AM, [unmask] wrote:
>
>>In a message dated 9/8/2003 9:21:48 AM Central Standard Time,
>>[unmask] writes:
>>
>>Interestingly multi-ethnic name given that "posh" is from Romany!
>>
>>
>>
>>That's interesting!  I had always heard that it was an acronym for
>>Port Outward, Starboard Home  which were the most expensive cabins in
>>the turn of the century luxery liners since they never got direct
>>sun.  What does it mean in Romany? and how old is it?
>George F. Madaus
>Boisi Professor of Education and Public Policy
>Senior Research Fellow
>National Board on Educational Testing and Public Policy
>Center for the Study of Testing Evaluation and Educational Policy
>Carolyn A. and Peter S. Lynch School of Education
>Boston College
>Chestnut Hill MA 02467
>[unmask]
>617. 552.4521
>617 552 8419 FAXI read an  article somewhere that challenged both these derivations.
Only I cannot remember where. It concluded that  Port Out Starboard
Home was clearly wrong, and Romany was unproven.
--
Alan Ackerman, [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Fwd: Re: Posh etymology
From: Alan Ackerman <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 18:55:46 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(51 lines)


There is an Urban Legends page on this. See
<http://www.urbanlegends.com/language/etymology/posh_etymology_of.html>.
It quotes The Browser's Dictionary by John Ciardi, favoring the
Romany origin>Date: Mon, 8 Sep 2003 18:44:00 -0700
>From: Alan Ackerman <[unmask]>
>Subject: Re: Posh etymology
>Cc:
>Bcc:
>X-Attachments:
>
>>Likewise I was always told that POSH referred to the trip through the
>>Suez Canal to and from India Port Out  Starboard Home
>>
>>George
>>On Monday, September 8, 2003, at 10:33  AM, [unmask] wrote:
>>
>>>In a message dated 9/8/2003 9:21:48 AM Central Standard Time,
>>>[unmask] writes:
>>>
>>>Interestingly multi-ethnic name given that "posh" is from Romany!
>>>
>>>
>>>
>>>That's interesting!  I had always heard that it was an acronym for
>>>Port Outward, Starboard Home  which were the most expensive cabins in
>>>the turn of the century luxery liners since they never got direct
>>>sun.  What does it mean in Romany? and how old is it?
>>George F. Madaus
>>Boisi Professor of Education and Public Policy
>>Senior Research Fellow
>>National Board on Educational Testing and Public Policy
>>Center for the Study of Testing Evaluation and Educational Policy
>>Carolyn A. and Peter S. Lynch School of Education
>>Boston College
>>Chestnut Hill MA 02467
>>[unmask]
>>617. 552.4521
>>617 552 8419 FAX
>
>I read an  article somewhere that challenged both these derivations.
>Only I cannot remember where. It concluded that  Port Out Starboard
>Home was clearly wrong, and Romany was unproven.
>--
>
>Alan Ackerman, [unmask]--
Alan Ackerman, [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Tacoma Park news
From: Conrad Bladey ***Peasant**** <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 22:26:49 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(48 lines)


I was in Columbus Ohio and missed the festival....generally good.
Yes! Tacoma Park Nucular Free Zone!ConradBruce Olson wrote:
>
> edward cray wrote:
> >
> > List Mother:
> >
> > Bruce's message reminds me I wanted to suggest that we publish the names of the ballad-l subscribers.
> >
> > Those lurkers wishing anonymity could opt out.  Just like we do for
> > the bankjs, insurance companies and telephone solicitors>
>
> Opting out complicates things.
>
> I thought the present system on LISTSERV (no list of subscribers, as on
> our old majordomo server) awkward at first, but I've changed my mind. We
> get poster's email addresses on their postings here. Lurkers can't post
> here annonymously, and may have valid reasons why they don't want their
> e-mail address known generally known. I'd like to know who all the
> lurkers are, but that doesn't seem to me to be as important as
> protecting them for whatever the reason they want to be lurkers. The
> resent status doesn't cause the posters any difficulty that I can see.
>
> Whether sound or ridiculous, I take my postings here to be readily
> available to anyone who wants to look at them.
>
> Bruce Olson
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> subject index) </a>--
"I had to walk down the road with
my throat a little dry
ranting like Jimmy Durante
My mind was as clear as the clouds in the sky
And my debts were all outstanding
outstanding
In a field of debts outstanding
my outraged heart was handy
at borrowing a sorrow I could put off 'till tomorrow
and coming to no understanding"- Jawbone "Pilgrim At the Wedding"

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fwd: Re: Posh etymology
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 23:21:46 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(18 lines)


Alan Ackerman wrote:
>
> There is an Urban Legends page on this. See
> <http://www.urbanlegends.com/language/etymology/posh_etymology_of.html>.
> It quotes The Browser's Dictionary by John Ciardi, favoring the
> Romany origin
>Farmer and Henley's 'Slang and it Analogues' says 'posh' is
money, giving a quote of its use in 1888.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Fwd: Re: Posh etymology
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Mon, 8 Sep 2003 22:12:46 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


And James O. Halliwell's 1850 _Dictionary of Archaisms and Provincialisms_ gives "posh" as meaning "a great quantity."Ed----- Original Message -----
From: Bruce Olson <[unmask]>
Date: Monday, September 8, 2003 8:21 pm
Subject: Re: Fwd: Re: Posh etymology> Alan Ackerman wrote:
> >
> > There is an Urban Legends page on this. See
> > <."
> target="l">http://www.urbanlegends.com/language/etymology/posh_etymology_of.html>.> It quotes The Browser's Dictionary by John Ciardi, favoring the
> > Romany origin
> >
>
>
> Farmer and Henley's 'Slang and it Analogues' says 'posh' is
> money, giving a quote of its use in 1888.
>
> Bruce Olson
> --
> Roots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> http://www.erols.com/olsonw"> Click here for homepage (=
> subject index)
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Posh etymology
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 09:23:07 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(20 lines)


>> Interestingly multi-ethnic name given that "posh" is from Romany!
> That's interesting!  I had always heard that it was an acronym for
> Port Outward, Starboard Home  which were the most expensive cabins
> in the turn of the century luxery liners since they never got direct
> sun.Urban legend - try www.snopes.org, they should have something on it.
It's another of those things like "Fornication Under Command of the
King".> What does it mean in Romany?  and how old is it?As far as I know it means "posh" and has an etymology going back to
when Romany was only spoken in North India, but I don't have sources
handy.-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack/>   *   homepage for my CD-ROMs of Scottish traditional music; free stuff on food intolerance, music and Mac logic fonts.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: (Posh) Etymology and ballads
From: Jeffrey Kallen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 09:56:58 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(54 lines)


Dear balladeers,I'd also always heard the 'port out, starboard home' etymology for this
word, but my general rule for etymology is that any etymology that makes a
good story is usually not true. This discussion sent me off to
Beale/Partridge, who allude both to the nautical etymology and to a Romany
word of possible relation.Specifically, Beale (this is the 1989 version of Partridge, known as *A
Concise Dictionary of Slang and Unconventional English* and published in
London by Routledge, though no doubt it's also published in the US and may
even have been updated since 1989) says that "posh" is an underworld cant
term for 'money, specifically, a halfpenny or other coin of low value';
though the word is cited for the 19th century, Beale says that the term
also became obsolescent then. This meaning of "posh" he derives from Romany
"posh" meaning 'a half', as in "posh-horri" meaning 'a halfpenny' and
"posh-koorona", i.e. a 'half crown'. There is a related sense recorded
here, too, of "posh" meaning 'a dandy' which is given as Society slang
attested in 1897 but supposedly obsolete by 1920.The meaning 'stylish, smart', etc. was apparently in military usage first
but became general by 1919 -- except that it evidently shows up in
Cambridge University slang in 1903 as 'push' or 'poosh'. Beale says it may
have come from the noun "posh" (so the Romany theory is in), or that it may
be from Scottish "tosh" meaning 'clean, neat, trim'. The 'port out
starboard home' explanation Beale describes as 'ingenious and plausible'
but he is 'distrusting' of it. His own preference is as a contraction of
"polish", itself what he calls a "slovened [i.e. slovenly, not Slovenian!]
pronunciation of "polished".' This might sound a little far-fetched, but
the army usage may support it, considering the military phrase (also from
1917 or 1918) "poshed up", i.e. 'to make smart in appearance; to clean and
polish'.Did an underworld term for a small coin transmute into a term for lots of
money and the style that goes with it? Did the style element start out as
the prime feature of the word, and did the money element get added later?
Did the two reinforce each other, giving a hybrid that combines both money
and style?  (Either way, I think the ship story, like many folk
etymologies, only explains the word after the fact. I wouldn't discount it
on that basis -- it becomes part of what people know about the word,
whether it represents 'history' or not.)One thing I think ballads and etymology have in common is that direct
etymologies are often impossible to construct. It is better to look at
families of words that share some relations and mutual influences, much
like tune or song families. For just as many song texts come from (or
influence) other song texts, words come from words -- and it can be awfully
difficult to put together enough evidence to say that a certain word
'definitely' came from a certain source. Just like it's hard to prove that
a particular version of a traditional song is the original or first
version.Jeff Kallen

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 11:17:46 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(24 lines)


I think that "I am a poor, wayfaring stranger" has become so well
known, sung to such a constant tune, that everyone will recognize it.This has been said to be an Irish tune, and I think it has that feel,
but I've not seen any old country examples of tunes that are
particularly close to it.It is usually (but not always) minor.  In the following each syllable
is an eighth note and each ' extends it by an eighth note.  The tonic
is "l".  Notes in the octave below "l" are capitalized.  Notes in the
octave above "l" are preceded by "*".3/4
1: l l m | m'' r m r | d l'   (var: l l l | m'' etc.)
2: l l m | r'' d l S | l''    (var: l l m | r'' l d r | m'')
(Repeat 1 and 2.  If 2var, use 2 on repeat.)
3: m m s |*l'' m s*l | m r'   (3 and 4 are subject to several
4: m m s |*l'' m s s | m''     small variations.)
(Repeat 1 and 2, but many variations are found.)Is this an "old Irish tune"?--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Lurkers
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 12:25:36 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(17 lines)


Carly Gewirz wrote:
>
> think I mentioned that to Bruce Olsen about  fifteen years ago...it is
> positively frightening, what that man remembers!
> Carly Gewirz
...Fear not. I've never had time to figure out the intricies of techniques
for successfull blackmail, and success rests finally in getting all the
details right.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 12:40:33 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(42 lines)


John Garst wrote:
>
> I think that "I am a poor, wayfaring stranger" has become so well
> known, sung to such a constant tune, that everyone will recognize it.
>
> This has been said to be an Irish tune, and I think it has that feel,
> but I've not seen any old country examples of tunes that are
> particularly close to it.
>
> It is usually (but not always) minor.  In the following each syllable
> is an eighth note and each ' extends it by an eighth note.  The tonic
> is "l".  Notes in the octave below "l" are capitalized.  Notes in the
> octave above "l" are preceded by "*".
>
> 3/4
> 1: l l m | m'' r m r | d l'   (var: l l l | m'' etc.)
> 2: l l m | r'' d l S | l''    (var: l l m | r'' l d r | m'')
> (Repeat 1 and 2.  If 2var, use 2 on repeat.)
> 3: m m s |*l'' m s*l | m r'   (3 and 4 are subject to several
> 4: m m s |*l'' m s s | m''     small variations.)
> (Repeat 1 and 2, but many variations are found.)
>
> Is this an "old Irish tune"?
>
> --
> john garst    [unmask]I think that must be sol-fa notation, and that I can't read. If you
could do it in ABC I could stressed note code it and compare with tunes
in file COMCOD3.TXT on my website, where almost, if not all, known Irish
tunes through 1864 are stressed note coded. I'f the tune is considerably
variant, stressed note coding does not work well, and we are eagerly
awaiting Ann Dhu McLucas's new book on tune families, and seeing her 12
characteristics of tunes usefull for the purposes of identification of
variant tunes.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Nigel Gatherer <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 20:05:34 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(24 lines)


John Garst wrote:> 3/4
> 1: l l m | m'' r m r | d l'[Snip]This might help:X:585
T:I Am a Poor, Wayfaring Stranger
S:John Garst
Z:Nigel Gatherer
L:1/8
M:3/4
K:Dm
DDA | A3 GAG | F D2 DDA | G3 FDC | D3
AAc | d3 Acd | A G2 AAc | d3 Acc | A3
DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]--
Nigel Gatherer, Crieff, Scotland
[unmask]
http://www.argonet.co.uk/users/gatherer/

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Harry Clifton
From: Steve Gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 14:54:47 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


Hi,
This thread is really a continuation of a discussion in the <Sameness of
tunes> thread. I'll have to send the info in smallish bites as my server
keeps cutting me off when I try to send a lengthy message.
    Harry Clifton (1824-72) was one of the top Music Hall turns of the
1860s in Britain. He is mostly remembered for his Motto and character songs
and these went through a revival in the 1880s. he is reputed to have
written 500+ songs some of which have been collected in the late 19thC and
the 20thC and appear in folksong collections.
    His best-known songs appear to have been..
A Motto For Every man (c1865)
Jones's Musical Party (1864)
Paddle Your own canoe (1866)
Pulling Hard against the stream (1867)
Work Boys Work and be Contented (1867) tune Tramp, Tramp, Tramp.
     He travelled around England, Ireland & Scotland a lot & wrote songs
about the places where he was performing e.g. for my home city, Hull, he
wrote 'Faithless Maria, or, The Land of Green Ginger (1866) which is a
famous thoroughfare in Hull city centre. As you can gather from some of the
titles (Work Boys Work etc) his songs were meant to appeal to the middle
classes and contained messages of virtue to the common man.
More about my own collection anon.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Harry Clifton
From: Steve Gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 15:11:49 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(25 lines)


I have in my collection of sheet music about 25 pieces of his. I have 115
titles of songs performed by him, most of which I have copies on
broadsides. His most popular material was published by Hopwood and Crew,
usually with a portrait of him on the cover in character, similar in fact
to the sheets of Tony Pastor in the Levy collection.
     Those of the following marked * I have sheet music copies and those
marked # i have broadside copies.Those that appear in Folk Song CollectionsPaddle Your Own Canoe (1866) *
Pulling Hard Against the Stream (1867) *
Shabby Genteel (1868) writen by Henry S Leigh #
On Board of the Kangaroo #
Water Cresses or the Watercress Girl (1863) #
My Rattling mare & I (bef 1867) * Obviously a parody on My Old Wife.
The Rocky Road to Dublin (bef 1867) *
Mary Ann or the Roving Gardener (1865) *Those heard in Folk Clubs in BritainThe Calico Printer's Clerk (1865) *
Polly Perkins of Paddingon Green (1863) *
I am one of the Olden Time or Fifty Years Ago. (bef 1868) *
The Weepin' Willer or The Miller's daughter (1865) #

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 16:14:42 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(37 lines)


Nigel Gatherer wrote:
>
> John Garst wrote:
>
> > 3/4
> > 1: l l m | m'' r m r | d l'
>
> [Snip]
>
> This might help:
>
> X:585
> T:I Am a Poor, Wayfaring Stranger
> S:John Garst
> Z:Nigel Gatherer
> L:1/8
> M:3/4
> K:Dm
> DDA | A3 GAG | F D2 DDA | G3 FDC | D3
> AAc | d3 Acd | A G2 AAc | d3 Acc | A3
> DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
>
> --
> Nigel Gatherer, Crieff, Scotland
> [unmask]
> http://www.argonet.co.uk/users/gatherer/Sorry, no luck. Stressed note code is 15341515.
Several in my COMBCOD3.TXT (searched by CODEDSP9.EXE) come close to the
stressed note code here, but are wrong timing or wrong mode.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 16:28:57 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(48 lines)


>Nigel Gatherer wrote:
>>
>>  John Garst wrote:
>>
>>  > 3/4
>>  > 1: l l m | m'' r m r | d l'
>>
>>  [Snip]
>>
>>  This might help:
>>
>>  X:585
>>  T:I Am a Poor, Wayfaring Stranger
>>  S:John Garst
>>  Z:Nigel Gatherer
>>  L:1/8
>>  M:3/4
>>  K:Dm
>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3
>>  AAc | d3 Acd | A G2 AAc | d3 Acc | A3
>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
>>
>>  --
>>  Nigel Gatherer, Crieff, Scotland
>>  [unmask]
>>  http://www.argonet.co.uk/users/gatherer/
>
>Sorry, no luck. Stressed note code is 15341515.
>Several in my COMBCOD3.TXT (searched by CODEDSP9.EXE) come close to the
>stressed note code here, but are wrong timing or wrong mode.
>
>Bruce OlsonThanks, Bruce and Nigel.I hope that "wrong timing" doesn't merely mean 4/4 with the same
pattern as 3/4, e.g.,3/4
DDA | A3 GAG | F D2 DDA | G3 FDC | D3  etc.4/4
DDA | A5 GAG | F D4 DDA | G5 FDC | D5  etc.Also, mode differences don't invalidate tune relationships, in my book.--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Harry Clifton
From: Steve Gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 15:33:33 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


Other Songs of InterestAct on the Square #
The Adventures of Robinson Crusoe
As welcome as the flowers in May #
Isabella the Barber's daughter of Islington #
 Careless joe
 Charity Crow (bef 1867)
Cupid in the Kitchen (duet with wife, Fanny Edwards)
Darby Maguire #
The Dark Girl Dressed in Blue (1862)#
The Farmer's Daughter of Berkshire
The Happy Policeman
The hardware Line (c1865) #
I'll go and enlist for a sailor ,or The Unfortunate tailor
A Jolly Old Country Squire *
Jones's Musical Party (1864) *
Lannigan's Ball (c1866) *
Merry Old Uncle joe #
 The Mother-in-Law (c1860) #
My Old Wife *
Poor Old Mike (1863) #
The railway Belle (1865) #
Shelling Green Peas (1866) #
Sinbad the Sailor (medley)
Up with the lark in the morning *
Wait for the turn of the tide (1868) *
Waterford Boys #
The Wedding of Biddy McGrane #That's all for now.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 16:49:08 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(38 lines)


>>>  X:585
>>>  T:I Am a Poor, Wayfaring Stranger
>>>  S:John Garst
>>>  Z:Nigel Gatherer
>>>  L:1/8
>>>  M:3/4
>>>  K:Dm
>>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3
>>>  AAc | d3 Acd | A G2 AAc | d3 Acc | A3
>>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
>>>
>>>  --
>>>  Nigel Gatherer, Crieff, Scotland
>>>  [unmask]
>>>  http://www.argonet.co.uk/users/gatherer/
>>
>>Sorry, no luck. Stressed note code is 15341515.
>>Several in my COMBCOD3.TXT (searched by CODEDSP9.EXE) come close to the
>>stressed note code here, but are wrong timing or wrong mode.
>>
>>Bruce OlsonI'm not sure how you generate your stressed note code, Bruce, but I
would have come up with15531411  for the first line above, taking D as "1."  These are the
notes on the first and third beats of each measure.Alternatively, using a coarser grid, I would get5341 (notes on first beat of each measure)Even coarser:  54 (notes on first beat of first measures of each phrase)Another alternative: 5141 (notes on first beat of first measure of
each phrase plus the terminal note of each phrase).
--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Harry Clifton
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 17:03:16 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


Steve Gardham wrote:
>Thanks, for the info, and changing to a more meaningfull thread title.I'd like to go back to his "Lanigan's Ball". Titles are such treacherous
things to work with that I'd like to see if we're talking about the same
"Lanigan's Ball", text and tune as that in the Levy collection, with
words attribued to Pastor and music attributed to Neil Bryant.I've made an ABC of the tune, if that will help, but the fastest way
would be for you to compare Clifton's tune against that in the .GIF on
the Levy collection website. Sorry to make work for you, but since I
don't have Clifton's text or tune, I can't do it.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 17:09:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(51 lines)


>>>>  X:585
>>>>  T:I Am a Poor, Wayfaring Stranger
>>>>  S:John Garst
>>>>  Z:Nigel Gatherer
>>>>  L:1/8
>>>>  M:3/4
>>>>  K:Dm
>>>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3
>>>>  AAc | d3 Acd | A G2 AAc | d3 Acc | A3
>>>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
>>>>
>>>>  --
>>>>  Nigel Gatherer, Crieff, Scotland
>>>>  [unmask]
>>>>  http://www.argonet.co.uk/users/gatherer/
>>>
>>>Sorry, no luck. Stressed note code is 15341515.
>>>Several in my COMBCOD3.TXT (searched by CODEDSP9.EXE) come close to the
>>>stressed note code here, but are wrong timing or wrong mode.
>>>
>>>Bruce Olson
>
>I'm not sure how you generate your stressed note code, Bruce, but I
>would have come up with
>
>15531411  for the first line above, taking D as "1."  These are the
>notes on the first and third beats of each measure.When there is syncopation, as at the end of the first phrases of the
"coarse" and "fine" parts, I have trouble knowing what to do with
stressed notes.  Music books will tell you that the stress is
transferred to the longer note following the shorter on that falls on
the normally stressed beat, but this does not correspond to what I
hear.  Perhaps this type of syncopation should be treated as two
successive stressed notes.  Then I would get15531 1411  (Here I have separated the two phrases of the first line.)If you follow what the books say, you would get1551 1411   (Omits the first note of syncopated pair.)In my view, perhaps the most useful way of stripping the tune to its
essentials is51 41  (or 51 45 for var)
51 41  (Nigel's ABC needs a repeated first line)
84 85
51 41  (many vars differ here)
--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 17:28:38 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(73 lines)


John Garst wrote:
>
> >Nigel Gatherer wrote:
> >>
> >>  John Garst wrote:
> >>
> >>  > 3/4
> >>  > 1: l l m | m'' r m r | d l'
> >>
> >>  [Snip]
> >>
> >>  This might help:
> >>
> >>  X:585
> >>  T:I Am a Poor, Wayfaring Stranger
> >>  S:John Garst
> >>  Z:Nigel Gatherer
> >>  L:1/8
> >>  M:3/4
> >>  K:Dm
> >>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3
> >>  AAc | d3 Acd | A G2 AAc | d3 Acc | A3
> >>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
> >>
> >>  --
> >>  Nigel Gatherer, Crieff, Scotland
> >>  [unmask]
> >>  http://www.argonet.co.uk/users/gatherer/
> >
> >Sorry, no luck. Stressed note code is 15341515.
> >Several in my COMBCOD3.TXT (searched by CODEDSP9.EXE) come close to the
> >stressed note code here, but are wrong timing or wrong mode.
> >
> >Bruce Olson
>
> Thanks, Bruce and Nigel.
>
> I hope that "wrong timing" doesn't merely mean 4/4 with the same
> pattern as 3/4, e.g.,
>
> 3/4
> DDA | A3 GAG | F D2 DDA | G3 FDC | D3  etc.
>
> 4/4
> DDA | A5 GAG | F D4 DDA | G5 FDC | D5  etc.
>
> Also, mode differences don't invalidate tune relationships, in my book.
>
> --
> john garst    [unmask]I'm aware that timing isn't a final deterinming factor. In SE England
the first note (stressed) of each measure of a nominal 4/4 tune gets
'stretched' to give 5/4, and elsehere stretching 1st and 3rd quarter
notes gives 6/4. Modes, also, yes. A very few tunes are know that are
found in ionian(major), mixolydian, dorian, and aeolian(minor) variants.
When one allows for as much as a 2 stressed note difference and
disregards timing and mode, one has a very large number of possible
'coincidences' to check for, and that can be days of work.That's why I am hoping that Anne Dhu McLucas's 12 characteristics will
help us reduce the labor invoved.We may eventual find that the tune "Poor Wayfaing Stranger" is an old
Irish tune, but at this point we know that establishing the identity is
not going to be a trivial chore.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 17:45:11 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(58 lines)


John Garst wrote:
>
> >>>  X:585
> >>>  T:I Am a Poor, Wayfaring Stranger
> >>>  S:John Garst
> >>>  Z:Nigel Gatherer
> >>>  L:1/8
> >>>  M:3/4
> >>>  K:Dm
> >>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3
> >>>  AAc | d3 Acd | A G2 AAc | d3 Acc | A3
> >>>  DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
> >>>
> >>>  --
> >>>  Nigel Gatherer, Crieff, Scotland
> >>>  [unmask]
> >>>  http://www.argonet.co.uk/users/gatherer/
> >>
> >>Sorry, no luck. Stressed note code is 15341515.
> >>Several in my COMBCOD3.TXT (searched by CODEDSP9.EXE) come close to the
> >>stressed note code here, but are wrong timing or wrong mode.
> >>
> >>Bruce Olson
>
> I'm not sure how you generate your stressed note code, Bruce, but I
> would have come up with
>
> 15531411  for the first line above, taking D as "1."  These are the
> notes on the first and third beats of each measure.
>
> Alternatively, using a coarser grid, I would get
>
> 5341 (notes on first beat of each measure)
>
> Even coarser:  54 (notes on first beat of first measures of each phrase)
>
> Another alternative: 5141 (notes on first beat of first measure of
> each phrase plus the terminal note of each phrase).
> --
> john garst    [unmask]There are multiple possibilites for stressed note positions in 3/4 time.
(and I suspect that some, where I didn't have the song text to help me
figure them out, I've got miss-coded in my COMBCOD3.TXT file)
"Key to the Celer/ (new) Bob and Joan" is nominally 3/2, and sometimes
3/4, but it's |DAA da DAA da| in each measure, 2 stressed notes per
measure.As I remember Burl Ives' version of the song, stressed notes for our
case should be the simplest posibility, first note in each measure.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 18:25:46 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(15 lines)


>here are multiple possibilites for stressed note positions in 3/4 time.
>(and I suspect that some, where I didn't have the song text to help me
>figure them out, I've got miss-coded in my COMBCOD3.TXT file)
>"Key to the Celer/ (new) Bob and Joan" is nominally 3/2, and sometimes
>3/4, but it's |DAA da DAA da| in each measure, 2 stressed notes per
>measure.
>
>As I remember Burl Ives' version of the song, stressed notes for our
>case should be the simplest posibility, first note in each measure.
>
>Bruce OlsonFWIW, quite a few songs in The Sacred Harp are written in 2/2 and sung in 3/2.
--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 18:31:09 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Bruce Olson wrote:
>I should have added on my last posting that when stressed note
coding leads to many possibilities, then you can't solve the
'identity' problem on the basis of stressed notes. You have to go
back to the whole tunes in the posibilities list and compare with
your reference one.I have a possible way to do this if I do all the 'posibilities' tunes as
ABCs.As I pointed out in an earlier note in a reply to Jack Campin,
with the ABC player program on my website, I can plot the log of
note frequency vertically and playing time horizontally all on
one screen, (optional new vertical and horizontal scaling allows
higher resolution) and put any pair of tunes right on top of each
other, to see how close they are. I don't have much experience
with this, and I still don't know anything quantative about what
'variant' means, so how do I pass judgement on what I can see
that way?.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 23:37:53 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


>This might help:
>
>X:585
>T:I Am a Poor, Wayfaring Stranger
>S:John Garst
>Z:Nigel Gatherer
>L:1/8
>M:3/4
>K:Dm
>DDA | A3 GAG | F D2 DDA | G3 FDC | D3
>AAc | d3 Acd | A G2 AAc | d3 Acc | A3
>DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]Which is almost the same as "You've Got to Walk That Lonesome Valley"
and rather similar in structure to a blues melody.  Could it be of
African origin?This Scottish tune sounds a bit like a development from the same idea
but I'd guess it arose independently:X:6
T:Born in St Johnstone and burn'd in Dundee
S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
M:3/4
L:1/4
K:Dmin
DAG   |F>GA|FED   |C>DE|DAG|F>GA|A    f e   |d3||
Add/c/|A dc|FcA/G/|F>GA|AAG|F>GA|G/F/ D C/E/|D3|]-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 18:50:50 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(46 lines)


>Bruce Olson wrote:
>>
>
>I should have added on my last posting that when stressed note
>coding leads to many possibilities, then you can't solve the
>'identity' problem on the basis of stressed notes. You have to go
>back to the whole tunes in the posibilities list and compare with
>your reference one.
>
>I have a possible way to do this if I do all the 'posibilities' tunes as
>ABCs.
>
>As I pointed out in an earlier note in a reply to Jack Campin,
>with the ABC player program on my website, I can plot the log of
>note frequency vertically and playing time horizontally all on
>one screen, (optional new vertical and horizontal scaling allows
>higher resolution) and put any pair of tunes right on top of each
>other, to see how close they are. I don't have much experience
>with this, and I still don't know anything quantative about what
>'variant' means, so how do I pass judgement on what I can see
>that way?.I do something similar, except that I suppress the rhythm.  I plot
log frequency (idealized to match equal temperament) vs *syllable* of
text sung with the tune.  I put in bar lines appropriately, preceding
the most stressed notes, first beat of each measure.  In my view,
stressed notes are tune characteristics and rhythms are not.What you get, of course, is subject to interpretation.  In judging
tunes to be the "same," I usually rely most on stressed notes, final
notes of phrases (if they are not stressed), and "closeness" along
the log frequency axis.I'm probably pretty liberal about this.I claim, for example, that the tune that is now commonly sung to "I
am a man of constant sorrow" is the "same" as the first part of the
tune published as TENDER-HEARTED CHRISTIAN in William Walker,
Southern and Western Pocket Harmonist, Philadelphia, 1846.  See my
article, "Man of Constant Sorrow": Antecedents and Tradition, Country
Music Annual, 2002 (University Press of Kentucky).  I'm sure that
there are those who would disagree with calling these the "same"
tunes, but I don't think anyone could disagree much with saying that
they are closely related.
--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 18:59:45 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(46 lines)


>  >This might help:
>>
>>X:585
>>T:I Am a Poor, Wayfaring Stranger
>>S:John Garst
>>Z:Nigel Gatherer
>>L:1/8
>>M:3/4
>>K:Dm
>>DDA | A3 GAG | F D2 DDA | G3 FDC | D3
>>AAc | d3 Acd | A G2 AAc | d3 Acc | A3
>>DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]
>
>Which is almost the same as "You've Got to Walk That Lonesome Valley"It is close to *some* of the tunes sung with that text, Blind Willie
McTell (I think), not very close to others, such as that used by The
Carter Family.>and rather similar in structure to a blues melody.  Could it be of
>African origin?
>
>This Scottish tune sounds a bit like a development from the same idea
>but I'd guess it arose independently:
>
>X:6
>T:Born in St Johnstone and burn'd in Dundee
>S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
>M:3/4
>L:1/4
>K:Dmin
>DAG   |F>GA|FED   |C>DE|DAG|F>GA|A    f e   |d3||
>Add/c/|A dc|FcA/G/|F>GA|AAG|F>GA|G/F/ D C/E/|D3|]Many of the texts used with WAYFARING STRANGER and relatives are
meter 9898.  Is that true here?As G. P. Jackson pointed out, many of these texts also have a theme
of travel.  (I'm going there to meet my father, etc.)A rather close relative of the first phrase of WAYFARING STRANGER is
found, as I recall (and I'm a bit uncertain), in A. L. Lloyd's book.
It is from Bulgaria (again, I'm a bit uncertain, not having the book
at hand).
--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 00:32:21 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(48 lines)


>X:585
>T:I Am a Poor, Wayfaring Stranger
>S:John Garst
>Z:Nigel Gatherer
>L:1/8
>M:3/4
>K:Dm
>DDA | A3 GAG | F D2 DDA | G3 FDC | D3
>AAc | d3 Acd | A G2 AAc | d3 Acc | A3
>DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]Footnote: finally I figure out where Patrick Galvin got the tune
for his lament for James Connolly from...Which in turn reminded me of the second part of this one (I think
it's almost identical to the version in Daniel Dow's "Ancient
Scottish Melodies", but don't have a copy of that book handy).
There is an enormous amount of elaboration, but surely there's an
early "Wayfaring Stranger" peeping out from under the gracenotes.
(Could well be an old Irish harp tune, like several of the "Rorie
Dall" pieces printed in the 18th century).X:4
T:Am Bruadar
T:The Dream
T:The Quick Dream [Dow's title]
S:Celtic Melodies selected and arranged by a Highlander, pub Robert Purdie, Edinburgh 1823
N:I got this in M.S. and think it a most perfect piece of musical composition.
B:NLS Glen.399
N:no. LXVII
N:first e in bar 15 is f in the book (alternate suggested by pencil note)
M:3/4
L:1/8
Q:1/4=50
K:A Dorian
       B|c>A  {A}e2  d>c|{c}B>G {G}d2   ee//d//c//B//|c>d        e2    c>{c}e    |{e}d>B {B}A2
A{BAGA}B|c>A  {A}e2  d>c|{c}B>G {G}d3    z           |e/g/Ha/>g/ e2    c>{d}e    |{e}d>B    A A2||
 a      |a>b {ab}c'2 b>a|   a>g {g}e2   ze           |a/>e/a/b/  c'2   e>c'      |   b>a    az
ab      |c'a    Ta2  eTa|   g<e    d<e  A>B          |cd         eHa   c{defgag}e|{e}d>B {B}A2 z
 a      |ab      c'2 ba |   a>g    e2   ze/a//b//    |c'>a    {a}b2    a>g       |  Tg>e {e}a2 z
 a/b/   |c'b     a2  ea |   g<e    d<e HAB           |cd         ea {c}c{defgag}e|{e}d>B {B}A2 z|]-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 20:12:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Jack Campin wrote:
>>
> This Scottish tune sounds a bit like a development from the same idea
> but I'd guess it arose independently:
>
> X:6
> T:Born in St Johnstone and burn'd in Dundee
> S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
> M:3/4
> L:1/4
> K:Dmin
> DAG   |F>GA|FED   |C>DE|DAG|F>GA|A    f e   |d3||
> Add/c/|A dc|FcA/G/|F>GA|AAG|F>GA|G/F/ D C/E/|D3|]
>> Jack Campin:Wow, "Bonnie Susie Cleland" tune. Blaikie collected for Motherwell, but
my copy of Motherwell lacks the appendix where the music is. Did
Motherwell publish this tune?Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 20:26:27 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Jack Campin wrote:
>
> >T
> X:6
> T:Born in St Johnstone and burn'd in Dundee
> S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
> M:3/4
> L:1/4
> K:Dmin
> DAG   |F>GA|FED   |C>DE|DAG|F>GA|A    f e   |d3||
> Add/c/|A dc|FcA/G/|F>GA|AAG|F>GA|G/F/ D C/E/|D3|]
>
> -----------------------------------------------------------------------------
> Jack Campin:Jack, how about giving us a title list of the tunes in Blaikie's MS?
Not all the tunes Blaikie collected got into Motherwell's appendix, and
these are among the earliest Scots traditional tunes. (Also C. K.
Sharpe's tunes which I know you've seen).[Jack is a treasure house of info on almost every tune in any 18th or
early 19th century Scots MS]Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: BALLAD-L Digest - 8 Sep 2003 to 9 Sep 2003 - Special issue (#2003-63)Harry Clifton
From: Margaret MacArthur <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 22:30:17 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Re Harry CliftonSteve Gardham wrote:
>I am one of the Olden Time or Fifty Years Ago. (bef 1868)I sing  Fifty Years Ago as collected by HH Flanders in Bennington VT
The first and last verses follow.How wondrous are the changes since fifty years ago
When girls wore woolen dresses and boys wore pants of tow
Boots were made of cowhide, socks of homespun wool
And children did a half days work before they went to schoolYes everything has altered, I cannot tell the cause
Man is always tampering with natures wondrous laws
What on earth we're coming to does anybody know?
Everything has changed so much since fifty years agoIs this song related to Harry Clifton's?Margaret MacArthurMargaret MacArthur
Box 15 MacArthur Road
Marlboro VT 05344
802/254/2549
[unmask]
http://www.margaretmacarthur.com
from the heart of the Green Mountains

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Tue, 9 Sep 2003 23:30:10 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


Bruce Olson wrote:
>
> Jack Campin wrote:
> >
>
> >
> > This Scottish tune sounds a bit like a development from the same idea
> > but I'd guess it arose independently:
> >
> > X:6
> > T:Born in St Johnstone and burn'd in Dundee
> > S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
> > M:3/4
> > L:1/4
> > K:Dmin
> > DAG   |F>GA|FED   |C>DE|DAG|F>GA|A    f e   |d3||
> > Add/c/|A dc|FcA/G/|F>GA|AAG|F>GA|G/F/ D C/E/|D3|]
> >
>B. Bronson, 'Traditional Tunes of the Child Ballads' II, #65, at "Lady
Maisry" #2, gives "Susie Cleland" from the appendix to Motherwell's
'Minstrelsy', 1827.It's not the same tune that Jack Campin gave us above. It appears
that Andrew Blaikie collected two tunes for the ballad.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Ebay List - 09/09/03
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 00:09:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(140 lines)


Hi!        Since the next couple of days look busy, I am posted the Ebay
list a bit early this week.        SONGSTERS        3625985106 - THE HARDWARE SONGSTER, 1920?, $2.99 (ends Sep-17-03
11:56:22 PDT)        SONGBOOKS, ETC.        3549718547 - Ballads and Songs of Southern Michigan by Gardner
and Chickering, 1967 reprint, $9.99 (ends Sep-11-03 19:50:34 PDT)        3549722489 - Texas Folk Songs by Owens, 1976, $24.95 (ends
Sep-11-03 20:12:02 PDT)        3546727849 - The Ballad Book by Allingham, 1913 printing, $9.99
(eTo: [unmask]
Cc:
Bcc:
Subject: Ebay List - 09/09/03
Reply-To: Dolores Nichols <[unmask]>
Organization: D and D DataHi!        Since the next couple of days look busy, I am posted the Ebay
list a bit early this week.        SONGSTERS        3625985106 - THE HARDWARE SONGSTER, 1920?, $2.99 (ends Sep-17-03
11:56:22 PDT)        SONGBOOKS, ETC.        3549718547 - Ballads and Songs of Southern Michigan by Gardner
and Chickering, 1967 reprint, $9.99 (ends Sep-11-03 19:50:34 PDT)        3549722489 - Texas Folk Songs by Owens, 1976, $24.95 (ends
Sep-11-03 20:12:02 PDT)        3546727849 - The Ballad Book by Allingham, 1913 printing, $9.99
(ends Sep-12-03 09:30:32 PDT)        3549853829 - English County Folks Songs by Sharp, 1961, $19.99
(ends Sep-12-03 15:37:04 PDT)        3549862786 - Two Penny Ballads and Four Dollar Whiskey by
Byington & Goldstein, 1965, $5 (ends Sep-12-03 16:51:50 PDT)        3549864659 - More Traditional Ballads of Virginia by Davis,
1960, $9.99 (ends Sep-12-03 17:05:35 PDT)        3548828122 - ENGLISH AND SCOTTISH POPULAR BALLADS by ?, ?,
$4.25, (ends Sep-12-03 17:13:02 PDT)        3549866435 - Air Force Airs by Wallrich, 1957, $19 (ends
Sep-12-03 17:19:19 PDT)        3549873336 - Old Bush Songs, 1905, $14.99 (ends Sep-12-03
18:06:01 PDT)        3549874136 - The Scottish Folksinger by Buchan & Hall, 1973, $9
(ends Sep-12-03 18:12:26 PDT)        3549880478 - The Play-Party in Indiana: A Collection of
Folk-Songs and Games by Wolford, 1916, $9.99 (ends Sep-12-03 18:52:05
PDT)        3549897557 - The Celtic Garland. Translations of Gaelic and
English Songs; Popular Gaelic Readings, &c. by Sinclair, 1881, $17.50
(ends Sep-12-03 20:47:57 PDT)        2556652926 - Shanties by ?, 1972, $9.99 (ends Sep-13-03 09:35:04
PDT)        3548978787 - The Songs of Ireland by Hatton & Molloy, 1900?, 12
GBP, (ends Sep-13-03 11:46:40 PDT)        3548974995 - THE MERCIER BOOK OF OLD IRISH STREET BALLADS:
Volume 2 by Healy, 1969, $5.95 (ends Sep-13-03 15:00:00 PDT)        3550252866 - 8 books on Ireland inc. Historical Ballad Poetry of
Ireland by Brown, 1900, $12 (ends Sep-14-03 13:06:11 PDT)        2556938928 - Old Time Songs and Poetry of Newfoundland by Doyle,
1966, $9.35 (ends Sep-14-03 16:28:32 PDT)        2556383077 - Songs of American Sailormen by Colcord, 1938
edition, $9.99 (ends Sep-14-03 17:57:33 PDT)        3550326145 - English and Scottish Popular Ballads by Sargent &
Kittredge, 1932, $0.99 (ends Sep-14-03 18:24:39 PDT)        3241180797 - American Negro Folk Songs by White, 1928, $165
(ends Sep-14-03 18:25:47 PDT)        2552497633 - South Carolina Ballads, With a Study of the
Traditional Ballad To-Day by Smith, 1972 reprint, $11.38 (ends Sep-14-03
20:30:00 PDT)        3549772692 - The English and Scottish Popular Ballads by Child,
5 volumes, 1965 Dover edition, 100 GBP w/reserve (ends Sep-15-03
07:14:59 PDT)        2557071223 - CARSON ROBISON COLLECTION OF MOUNTAIN BALLADS AND
OLD TIME SONGS, 1930, $3 (ends Sep-15-03 09:41:11 PDT)        3550527333 - The British Broadside Ballad and its Music by
Simpson, 1966, $39.99 (ends Sep-15-03 16:17:02 PDT)        2557169300 - 2 songbooks (HANK KEENE'S COLLECTION OF HILL-BILLY,
MOUNTAINEER, AND COWBOY SONGS, 1932 and RUSTY GILL, COWBOY SONGS,
MOUNTAIN BALLADS, 1941), $14.95 (ends Sep-15-03 17:58:15 PDT)        3550578605 - Ancient Songs and Ballads by Ritson, 1877 edition,
$13 (ends Sep-15-03 20:29:57 PDT)        3550580629 - bushranger ballads by Scott, 1976, $1.99 AU (ends
Sep-15-03 20:42:28 PDT)        3550813349 - Hell-Bound Train: A Cowboy Songbook by Ohrlin,
1974, $14.50 (ends Sep-16-03 19:52:58 PDT)        MISCELLANEOUS        2556548356 - Manuscript copy of the Ballad, Brave Wolfe supposed
dated 1760, $99 (ends Sep-15-03 16:13:50 PDT)                                Happy Bidding!
                                Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 01:06:59 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(23 lines)


Bruce Olson wrote:
>...Unsung Andrew Blaikie, one of my heros, noted down tunes of
traditional singers for Wm. Motherwell, or Motherwell got his
tunes and somehow got permission to publish these with little
credit to Blaikie.
Where would Scottish and Irish music history be without Andrew Blaikie?
Blaikie was, by profession, a music engraver, and see 'Blaikie'
in the Irish tune index on my website for an Irish tune
collection that he engraved (with many of Jackson's tunes). He
also, somehow, came by two Scots MS of late 17th century tunes.
Search for 'Blaikie' in the Scots tunes in MSS file on my website
(SCOTMS.HTM) for 'Blaikie' and there, for BVMS and BVMSA, for the
contents of his old MSS, and what happened to them (my 'researches'
here are not all cribbed from Nelly Diem, qv, in SCOTMS.HTM).Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Harry Clifton
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 00:50:27 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


----- Original Message -----
From: Steve Gardham <[unmask]>I'll go and enlist for a sailor ,or The Unfortunate tailor
Up with the lark in the morning *
Wait for the turn of the tide (1868) *I believe these have also been heard in British folk clubs, and occasionally
North American as well.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Nigel Gatherer <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 05:18:02 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


John Garst wrote:> (Nigel's ABC needs a repeated first line)Oops! Sorry, I transposed in rather a hurry...X:585
T:I Am a Poor, Wayfaring Stranger
S:John Garst
Z:Nigel Gatherer
L:1/8
M:3/4
K:Dm
DDA | A3 GAG | F D2 DDA | G3 FDC | D3
DDA | A3 GAG | F D2 DDA | G3 FDC | D3
AAc | d3 Acd | A G2 AAc | d3 Acc | A3
DDA | A3 GAG | F D2 DDA | G3 FDC | D3 |]--
Nigel Gatherer, Crieff, Scotland
[unmask]
http://www.argonet.co.uk/users/gatherer/

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 01:12:28 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


----- Original Message -----
From: John Garst <[unmask]><<A rather close relative of the first phrase of WAYFARING STRANGER is
found, as I recall (and I'm a bit uncertain), in A. L. Lloyd's book.
It is from Bulgaria (again, I'm a bit uncertain, not having the book
at hand).>>The Bulgarian tune in the first chapter is in 5/16 and not particularly
close to Wayfaring Stranger. I think you were remembering the
Moravian-Slovak tune on p. 47, which is a lot closer by my ear.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 02:07:01 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


>> T:Born in St Johnstone and burn'd in Dundee
>> S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
> Wow, "Bonnie Susie Cleland" tune. Blaikie collected for Motherwell,
> but my copy of Motherwell lacks the appendix where the music is.
> Did Motherwell publish this tune?As far as I know it's only in the MS - Bronson missed it.  I like it.I don't know a version of "Bonnie Susie Cleland" with short enough
lines to fit that tune, but you can edit some of the known versions
down to fit pretty well (in some cases with a literary improvement).-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack/>   *   homepage for my CD-ROMs of Scottish traditional music; free stuff on food intolerance, music and Mac logic fonts.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 07:36:38 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


Jack Campin wrote:
>
> >> T:Born in St Johnstone and burn'd in Dundee
> >> S:Blaikie MS, NLS MS.1578/Mf.Sec.MSS.295
> > Wow, "Bonnie Susie Cleland" tune. Blaikie collected for Motherwell,
> > but my copy of Motherwell lacks the appendix where the music is.
> > Did Motherwell publish this tune?
>
> As far as I know it's only in the MS - Bronson missed it.  I like it.
>
> I don't know a version of "Bonnie Susie Cleland" with short enough
> lines to fit that tune, but you can edit some of the known versions
> down to fit pretty well (in some cases with a literary improvement).
>
> -----------------------------------------------------------------------------
> Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
> <http://www.purr.demon.co.uk/jack/>   *   homepage for my CD-ROMs of Scottish traditional music; free stuff on food intolerance, music and Mac logic fonts.I didn't consciously ignore the posting above when I noted that Jack's
tune isn't in Bronson. I didn't receive Jack's posting above until about
5 hours after I posted my note.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 10:25:20 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(32 lines)


Posts in this thread flew too fast for me to keep up yesterday.John Garst wrote:
>
> I do something similar, except that I suppress the rhythm.  I plot
> log frequency (idealized to match equal temperament) vs *syllable* of
> text sung with the tune.  I put in bar lines appropriately, preceding
> the most stressed notes, first beat of each measure.  In my view,
> stressed notes are tune characteristics and rhythms are not.
>I'm lost here. Do you stressed note code the whole tune? I only do the
first 8 stressed notes.For ABCs, not stressed notes:
My ABC player program tests the number of actual notes greater than or =
to an eighth note in each of the first 4 measures. I get a good idea of
how much note splitting there is. With this note count I then make up
statements for locating stressed notes automatically, and do it for
every timing, 2/2, 2/4 (and 4/8 scored as 2/4), C = C| = 4/4, (and 8/8
scored as 4/4), 3/2, 3/4, 3/8, 6/4, 6/8, 9/8, 12/8, and 5/4. I know it
won't work perfectly every time.> john garst    [unmask]Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: For tune sleuths
From: John Garst <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 11:12:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


>Posts in this thread flew too fast for me to keep up yesterday.
>
>John Garst wrote:
>>
>>  I do something similar, except that I suppress the rhythm.  I plot
>>  log frequency (idealized to match equal temperament) vs *syllable* of
>>  text sung with the tune.  I put in bar lines appropriately, preceding
>>  the most stressed notes, first beat of each measure.  In my view,
>>  stressed notes are tune characteristics and rhythms are not.
>>
>
>I'm lost here. Do you stressed note code the whole tune? I only do the
>first 8 stressed notes.
>...
>Bruce OlsonI don't do this for archival purposes, just for tune comparisons.
Thus, I don't generate a stressed note code routinely (though I
could).I plot the whole tune.  I plot syllables along the x-axis, alloting
equal space to each.  I plot log frequency along the y-axis.  Thus,
each syllable that has only one pitch is represented by a horizontal
bar.  I put vertical measure bars on the plot so that one can
visually find the stressed notes.  If a syllable receives more than
one pitch, then I divide the space alloted to that syllable into
fractions and plot all the pitches the syllable gets, in sequence.
For comparisons, I plot two tunes on the same graph, using bold lines
for one and hashed lines for the other, except where the two
coincide, where I use an ordinary line.  Examples are in the article
I mentioned earlier, Country Music Annual, 2002 (University Press of
Kentucky).
--
john garst    [unmask]

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: BALLAD-L Digest - 8 Sep 2003 to 9 Sep 2003 - Special issue (#2003-63)Harry Clifton
From: steve gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 18:23:35 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(39 lines)


Sorry Margaret, Different song but the sentiments are the same. Steve
----- Original Message -----
From: "Margaret MacArthur" <[unmask]>
To: <[unmask]>
Sent: Wednesday, September 10, 2003 4:30 AM
Subject: Re: BALLAD-L Digest - 8 Sep 2003 to 9 Sep 2003 - Special issue
(#2003-63)Harry Clifton> Re Harry Clifton
>
> Steve Gardham wrote:
> >I am one of the Olden Time or Fifty Years Ago. (bef 1868)
>
> I sing  Fifty Years Ago as collected by HH Flanders in Bennington VT
> The first and last verses follow.
>
> How wondrous are the changes since fifty years ago
> When girls wore woolen dresses and boys wore pants of tow
> Boots were made of cowhide, socks of homespun wool
> And children did a half days work before they went to school
>
> Yes everything has altered, I cannot tell the cause
> Man is always tampering with natures wondrous laws
> What on earth we're coming to does anybody know?
> Everything has changed so much since fifty years ago
>
> Is this song related to Harry Clifton's?
>
> Margaret MacArthur
>
> Margaret MacArthur
> Box 15 MacArthur Road
> Marlboro VT 05344
> 802/254/2549
> [unmask]
> http://www.margaretmacarthur.com
> from the heart of the Green Mountains
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Harry Clifton
From: steve gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 18:38:57 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(45 lines)


Sorry,Margaret,
This is a different song though the sentiments are the same. The first line
is..Oh I was born some years ago when George the Third was king....and the
chorus....Yes I am one of the olden time, and may be thought too slow, but
give to me the good old days of fifty years ago. Helen Watson of Mukram
Wakes  used to sing it in british folk clubs.
Steve
               ----- Original Message -----
From: "Margaret MacArthur" <[unmask]>
To: <[unmask]>
Sent: Wednesday, September 10, 2003 4:30 AM
Subject: Re: BALLAD-L Digest - 8 Sep 2003 to 9 Sep 2003 - Special issue
(#2003-63)Harry Clifton> Re Harry Clifton
>
> Steve Gardham wrote:
> >I am one of the Olden Time or Fifty Years Ago. (bef 1868)
>
> I sing  Fifty Years Ago as collected by HH Flanders in Bennington VT
> The first and last verses follow.
>
> How wondrous are the changes since fifty years ago
> When girls wore woolen dresses and boys wore pants of tow
> Boots were made of cowhide, socks of homespun wool
> And children did a half days work before they went to school
>
> Yes everything has altered, I cannot tell the cause
> Man is always tampering with natures wondrous laws
> What on earth we're coming to does anybody know?
> Everything has changed so much since fifty years ago
>
> Is this song related to Harry Clifton's?
>
> Margaret MacArthur
>
> Margaret MacArthur
> Box 15 MacArthur Road
> Marlboro VT 05344
> 802/254/2549
> [unmask]
> http://www.margaretmacarthur.com
> from the heart of the Green Mountains
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Harry Clifton
From: Steve Gardham <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 13:05:48 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(12 lines)


Bruce, re Lannigan's Ball, Undoubtedly the same song although Clifton's has
two ns and his version has 7 verses as opposed to Pastor's 6. There is no
chorus to Clifton's version ..first line 'In the town of Athy one Jeremy
Lannigan battered away till he hadn't a pound' The tune is pretty much the
same I'd say but I'm not an expert at music reading (I'm an ear musician)
and the key is E flat (three flats?)It is in jig time and an attempt at
singing it through  it reminds me of an Irish tune called Nell Flaherty's
Drake. The cover has on it a portrait/ litho of Clifton in Irish character
wielding a stick, with a ceili in the background. Also underneath it
says 'Written expressly  by D.K.Gavan, The Galway Poet, for Harry Clifton.'
Inside it says arranged by John Candy.
Hope this is of some use. Steve.

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Harry Clifton
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 14:59:28 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(19 lines)


Steve Gardham wrote:
>> singing it through  it reminds me of an Irish tune called Nell >Flaherty's Drake. I have that around somewhere.> wielding a stick, with a ceili in the background. Also underneath it
> says 'Written expressly  by D.K.Gavan, The Galway Poet, for Harry Clifton.'Thanks Steve,That's going to take a while to digest.
Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Blaikie MS (NLS MS.1578)
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 00:58:40 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(187 lines)


> Jack, how about giving us a title list of the tunes in Blaikie's MS?
> Not all the tunes Blaikie collected got into Motherwell's appendix,
> and these are among the earliest Scots traditional tunes. (Also C. K.
> Sharpe's tunes which I know you've seen).There is more than one C.K. Sharpe MS, which do you mean?Here's Blaikie as requested...Blaikie MS (MS.1578)MS has the tunes numbered, but some alternate sets or nameless tunes don't
get numbers.  The owner who did the pencil annotations (William Motherwell?)
renumbered them all. Pencil notes are in (...) parentheses, my notes are in
[...].To Sir Walter Scott/ of Abbotsford Bart./ from his most obedient/ and very
humble servant/ Andw. Blaikie/ 27. July 1824. [pencil note in Murdoch
Henderson's writing: "1822 paper",  but I can't see any watermarks]1  Sweet Willie
-  Sweet Willie - a different sett
2  The bonny brow or In January last
3  Jocky wed a owing go
4  Jockie went to the wood or Jockie went too
5  Jockie drucken bauble
6  Ballou
7  Honest Lucky
8  Drumlanrick's Air
9  The lad's gane
10 Jock the Laird's brother
11 Bonie Nanie
12 The Capita me
13 Women's work will never be done
14 The Beed to me
15 Abbay hills Rant
16 Hiland Ladie
17 Put up thy dagor Jennie
18 My Lady Errol's Lament
19 My Lady Monteith's Lament
20 Montrose Lynes
21 Montrosse March
22 Bonnie Lassie
23 Bonny Christon
24 Lady Binney's Lilt
25 New Corn rigs
26 Mack Beth
27 Franklin is fled far away
28 Song with text [Ye woods and groves and purling streams][Blaikie's note at this point:] The foregoing 28 tunes are taken
from two M.S. books bearing date 1683 and 1692.29 [untitled]
30 Go to the windward my love (Beautiful)
31 And when we part we'll meet again (pretty)
32 The cruel Father (pretty)
33 There came a Maid (pretty)
34 [untitled] (pretty)
35 [untitled]
36 [untitled] (pretty)
37 Johnie of Airlegreen
38 Our Jean's aye in the right o't
38 [untitled]
40 A Lady walking in her garden (very nearly the same with ance crowdie twice crowdie)
41 [untitled] (this seems a dancing tune)
42 O will ye marry my daughter Janet
43 The silly bit chicken cast it a pickle and it will grow mickle and it will do gude
44 The Douglas Tragedy
45 [untitled] (I have heard the Broom of the Cowdenknows sung
               to this No.45. In Smith's collection May Colvin)
46 [untitled] (pretty)
47 [untitled] (ordinary)
48 Kate Carnagie
-  A different set of Kate Carnagie
49 Matthew Malone (is this not Irish by its name?)
50 The clairty Cook of Torwoodlee (the same as Elsey Marlie)
51 The three Maries (not pretty, & vulgar)
-  The three Maries - a little different (do.)
52 The Lass of Lochryan (not nearly so good as the common one)
-  The poor man's labour's never done
53 The Knight in Jessemont (not ugly)
54 Bonny Billie (The battle of Bothwell Brigg)
55 The King of Fairies or The Roses they smell sweetly (Lord Maxwell's goodnight)
-  The King of Fairies  a different set
56 Little Jock Elliot or Whae dare meddle wi' me
57 The Jew's daughter (very pretty & will do for some other ballad)
58 Lady Margerie (almost the same as Lammikin & will serve as 2. part to it & prevent monotony)
59 Drowzy Lane
60 Young Essex (very pretty)
61 Taffy or Irae Corona
62 Earl Landale (set in vol 1st)
-  Lord Ingram - a slight variation of the above (2d. part to the above)
63 Thomas the Rhymer (set already in Vol 1st. of Ballads)
64 The Mill dams of Binnorie (Set in Vol. 1st. after the other tune)
65 Oxter my Lassie
66 Awake my fairest creature
67 The French Gallerie O (is this not English. Words wanted)
68 Earl Aboyne or Peggy Irvine
69 The Lochmaben Harper (set already)
70 Brinny O Linn (Irish?-)
71 Earl Aboyne
72 Dysmal
73 When first I came to Edinburro
74 Niddlety noddlety
75 Lord Johnny Scott (a little different from our set of John the Little Scott)
76 Janet of Carterhaugh (not so good as our own set)
77 Duncan Swan
78 Fause Foodrage (mainly the same with ours)
79 Argyle's Courtship
80 Sally Green
81 [untitled] (very pretty and likely to have a relationship to No. 85 opposite)
82 I'll dye my Ribbons
83 Hey burdy croon
84 There was a youthful Lawyer
85 Born in St. Johnstone & burn'd in Dundee (very beautiful, Q. are
                                             the words fit & to be had)
86 Love will find out the way
87 The winter it is past and the summer's come at last (pretty)
88 Thus I gain'd my pretty fair maid (same tune as There was
                                      a Lawyer & a sawyer)
90 The wee wedding
91 The wee wedding
92 The fit's come o'er me now
93 [untitled] (pretty I think)
94 Robin Hood & the Beggar (What are the words. The tune seems good.)
95 Cock Robin's Testament (chorus words of this wanted)
96 Cock Robin's Testament - a different air
97 Rosanna - In Oxford lived a Lady fair
98 The cruel Father (pretty. same as No. 33)
   [note in Murdoch Henderson's writing: same
    treble but different bass from no. 33]
99 The Spanish Lady (a queer tune. what are the words)
100 O what a foolish Girl was I
101 He chac'd me to my Daddie's door
102 Good Lord Scroope alias Hughie Graham (not so pretty as our own set)
103 The Weaver Lad
104 The Ramalies (not ugly)
105 Lambkin
106 King William going out a hunting (pretty. what words?)
107 Ye sit in the sun sae louzy
108 When I was a young man
109 It fell upon a certain day
110 A Lady walking in her garden (not ugly)
111 The three Maries (very pretty for 2nd. part v. the other book p.1)
112 The King & the Tinker (pretty)
113 Go fetch me Lord Thomas (not ugly - what words has it?)
114 [untitled] (pretty)
115 The land of fair Virginia O (not unlike the other but the
                                 common one is [?] this magic [?])
116 Johnnie Armstrong (neither of these so pretty as our own I think)
117 Johnnie Armstrong - a little different from the above
118 [untitled]
119 A penny worth of wit
120 [untitled]
121 And a begging we will go
122 My bosom burns
123 Herd the Cows
124 Gude e'en to ye auld man
125 Katie Scroggie
126 Earl of Crawford (not ugly)
127 Johnny of Braidislee (mainly the same as our own but not so good)
128 Tammas has ridden & Tammas has runAnd here's the other tune for comparison...X:1
T:untitled no.81
S:NLS MS.1578
Z:Jack Campin 2003
M:3/4
L:1/4
K:E Minor
B,|E  G F/E/|F d ^c| B    G  F/E/|FD \
B,|E  G F/E/|F d ^c| B/A/ G  F   |E2||
B |d ^c B   |e B  d|^c    B  G   |FD \
B,|d ^c B   |e B  A| B    e ^d   |e2
B |d ^c d   |e B  d|^c    B  G   |FD \
B,|E  G F/E/|F d ^c| B/A/ G  F   |E2|]-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 21:04:26 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(208 lines)


Jack Campin wrote:
>
> > Jack, how about giving us a title list of the tunes in Blaikie's MS?
> > Not all the tunes Blaikie collected got into Motherwell's appendix,
> > and these are among the earliest Scots traditional tunes. (Also C. K.
> > Sharpe's tunes which I know you've seen).
>
> There is more than one C.K. Sharpe MS, which do you mean?
>
> Here's Blaikie as requested...
>
> Blaikie MS (MS.1578)
>
> MS has the tunes numbered, but some alternate sets or nameless tunes don't
> get numbers.  The owner who did the pencil annotations (William Motherwell?)
> renumbered them all. Pencil notes are in (...) parentheses, my notes are in
> [...].
>
> To Sir Walter Scott/ of Abbotsford Bart./ from his most obedient/ and very
> humble servant/ Andw. Blaikie/ 27. July 1824. [pencil note in Murdoch
> Henderson's writing: "1822 paper",  but I can't see any watermarks]
>
> 1  Sweet Willie
> -  Sweet Willie - a different sett
> 2  The bonny brow or In January last
> 3  Jocky wed a owing go
> 4  Jockie went to the wood or Jockie went too
> 5  Jockie drucken bauble
> 6  Ballou
> 7  Honest Lucky
> 8  Drumlanrick's Air
> 9  The lad's gane
> 10 Jock the Laird's brother
> 11 Bonie Nanie
> 12 The Capita me
> 13 Women's work will never be done
> 14 The Beed to me
> 15 Abbay hills Rant
> 16 Hiland Ladie
> 17 Put up thy dagor Jennie
> 18 My Lady Errol's Lament
> 19 My Lady Monteith's Lament
> 20 Montrose Lynes
> 21 Montrosse March
> 22 Bonnie Lassie
> 23 Bonny Christon
> 24 Lady Binney's Lilt
> 25 New Corn rigs
> 26 Mack Beth
> 27 Franklin is fled far away
> 28 Song with text [Ye woods and groves and purling streams]
>
> [Blaikie's note at this point:] The foregoing 28 tunes are taken
> from two M.S. books bearing date 1683 and 1692.
>
> 29 [untitled]
> 30 Go to the windward my love (Beautiful)
> 31 And when we part we'll meet again (pretty)
> 32 The cruel Father (pretty)
> 33 There came a Maid (pretty)
> 34 [untitled] (pretty)
> 35 [untitled]
> 36 [untitled] (pretty)
> 37 Johnie of Airlegreen
> 38 Our Jean's aye in the right o't
> 38 [untitled]
> 40 A Lady walking in her garden (very nearly the same with ance crowdie twice crowdie)
> 41 [untitled] (this seems a dancing tune)
> 42 O will ye marry my daughter Janet
> 43 The silly bit chicken cast it a pickle and it will grow mickle and it will do gude
> 44 The Douglas Tragedy
> 45 [untitled] (I have heard the Broom of the Cowdenknows sung
>                to this No.45. In Smith's collection May Colvin)
> 46 [untitled] (pretty)
> 47 [untitled] (ordinary)
> 48 Kate Carnagie
> -  A different set of Kate Carnagie
> 49 Matthew Malone (is this not Irish by its name?)
> 50 The clairty Cook of Torwoodlee (the same as Elsey Marlie)
> 51 The three Maries (not pretty, & vulgar)
> -  The three Maries - a little different (do.)
> 52 The Lass of Lochryan (not nearly so good as the common one)
> -  The poor man's labour's never done
> 53 The Knight in Jessemont (not ugly)
> 54 Bonny Billie (The battle of Bothwell Brigg)
> 55 The King of Fairies or The Roses they smell sweetly (Lord Maxwell's goodnight)
> -  The King of Fairies  a different set
> 56 Little Jock Elliot or Whae dare meddle wi' me
> 57 The Jew's daughter (very pretty & will do for some other ballad)
> 58 Lady Margerie (almost the same as Lammikin & will serve as 2. part to it & prevent monotony)
> 59 Drowzy Lane
> 60 Young Essex (very pretty)
> 61 Taffy or Irae Corona
> 62 Earl Landale (set in vol 1st)
> -  Lord Ingram - a slight variation of the above (2d. part to the above)
> 63 Thomas the Rhymer (set already in Vol 1st. of Ballads)
> 64 The Mill dams of Binnorie (Set in Vol. 1st. after the other tune)
> 65 Oxter my Lassie
> 66 Awake my fairest creature
> 67 The French Gallerie O (is this not English. Words wanted)
> 68 Earl Aboyne or Peggy Irvine
> 69 The Lochmaben Harper (set already)
> 70 Brinny O Linn (Irish?-)
> 71 Earl Aboyne
> 72 Dysmal
> 73 When first I came to Edinburro
> 74 Niddlety noddlety
> 75 Lord Johnny Scott (a little different from our set of John the Little Scott)
> 76 Janet of Carterhaugh (not so good as our own set)
> 77 Duncan Swan
> 78 Fause Foodrage (mainly the same with ours)
> 79 Argyle's Courtship
> 80 Sally Green
> 81 [untitled] (very pretty and likely to have a relationship to No. 85 opposite)
> 82 I'll dye my Ribbons
> 83 Hey burdy croon
> 84 There was a youthful Lawyer
> 85 Born in St. Johnstone & burn'd in Dundee (very beautiful, Q. are
>                                              the words fit & to be had)
> 86 Love will find out the way
> 87 The winter it is past and the summer's come at last (pretty)
> 88 Thus I gain'd my pretty fair maid (same tune as There was
>                                       a Lawyer & a sawyer)
> 90 The wee wedding
> 91 The wee wedding
> 92 The fit's come o'er me now
> 93 [untitled] (pretty I think)
> 94 Robin Hood & the Beggar (What are the words. The tune seems good.)
> 95 Cock Robin's Testament (chorus words of this wanted)
> 96 Cock Robin's Testament - a different air
> 97 Rosanna - In Oxford lived a Lady fair
> 98 The cruel Father (pretty. same as No. 33)
>    [note in Murdoch Henderson's writing: same
>     treble but different bass from no. 33]
> 99 The Spanish Lady (a queer tune. what are the words)
> 100 O what a foolish Girl was I
> 101 He chac'd me to my Daddie's door
> 102 Good Lord Scroope alias Hughie Graham (not so pretty as our own set)
> 103 The Weaver Lad
> 104 The Ramalies (not ugly)
> 105 Lambkin
> 106 King William going out a hunting (pretty. what words?)
> 107 Ye sit in the sun sae louzy
> 108 When I was a young man
> 109 It fell upon a certain day
> 110 A Lady walking in her garden (not ugly)
> 111 The three Maries (very pretty for 2nd. part v. the other book p.1)
> 112 The King & the Tinker (pretty)
> 113 Go fetch me Lord Thomas (not ugly - what words has it?)
> 114 [untitled] (pretty)
> 115 The land of fair Virginia O (not unlike the other but the
>                                  common one is [?] this magic [?])
> 116 Johnnie Armstrong (neither of these so pretty as our own I think)
> 117 Johnnie Armstrong - a little different from the above
> 118 [untitled]
> 119 A penny worth of wit
> 120 [untitled]
> 121 And a begging we will go
> 122 My bosom burns
> 123 Herd the Cows
> 124 Gude e'en to ye auld man
> 125 Katie Scroggie
> 126 Earl of Crawford (not ugly)
> 127 Johnny of Braidislee (mainly the same as our own but not so good)
> 128 Tammas has ridden & Tammas has run
>
> And here's the other tune for comparison...
>
> X:1
> T:untitled no.81
> S:NLS MS.1578
> Z:Jack Campin 2003
> M:3/4
> L:1/4
> K:E Minor
> B,|E  G F/E/|F d ^c| B    G  F/E/|FD \
> B,|E  G F/E/|F d ^c| B/A/ G  F   |E2||
> B |d ^c B   |e B  d|^c    B  G   |FD \
> B,|d ^c B   |e B  A| B    e ^d   |e2
> B |d ^c d   |e B  d|^c    B  G   |FD \
> B,|E  G F/E/|F d ^c| B/A/ G  F   |E2|]
>
> -----------------------------------------------------------------------------
> Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
> <http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
> Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
> ---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---Many thanks, JackOnes from Blaikie's MSS of 1683 and 1692 are in the SCOTSMS.HTM file on
my website. There's a lot of overlap with the Leyden MS of 1692.Among thr later ones I recognize some broadside titles or 1st lines.
I'll work on identifying the tunes, but I'm committed to other business
tomorrow, at least.C. K. Sharpe's tunes I don't have much of an account of. I'm intrested
in any he himself might have collected, if these can be sorted out from
those added by Lady John Scott, to see if any are for the songs in his
'A Ballad Book' (without music).Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 21:34:37 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(45 lines)


Jack Campin wrote:
>
> > Jack, how about giving us a title list of the tunes in Blaikie's MS?
> > Not all the tunes Blaikie collected got into Motherwell's appendix,
> > and these are among the earliest Scots traditional tunes. (Also C. K.
> > Sharpe's tunes which I know you've seen).
>
> There is more than one C.K. Sharpe MS, which do you mean?
>
> Here's Blaikie as requested...
>
> Blaikie MS (MS.1578)
>
> MS has the tunes numbered, but some alternate sets or nameless tunes don't
> get numbers.  The owner who did the pencil annotations (William Motherwell?)
> renumbered them all. Pencil notes are in (...) parentheses, my notes are in
> [...].
>[Crazy internet. This is s second try to send this to ballad-l as a
Reply, the first just came back to me. Ed Cray, did you get the STS
email address I sent you earlier today? It just came back to me, but
still addressed to you.]See 'Blaikie in the file SCOTMS.HTM on my website for what I could
piece together on Blaikie's MSS of 1683 and 1692 (both originals now
lost). Wm. Chappell, PMOT, said the latter MS was for bass viol, had 112
tunes, and contained the statement 'Lady Katherine Boyd aught this
book.' Wighton Library website has a facsimile of a page of a transcript
of one of the Blaikie MSS. John Glen's transcripts from Blaikie, 1692,
aren't from Blaikie's copies you have found, but apparently from the
Wighton partial transcript, and from the 112 tunes that Chappell said
were in the MS many are missing, so we might find some that Blaikie
copied that didn't get into the Wighton partial transcript. Wm. Dauny,
'Ancient Scottish Melodies', 1838, gave a few tunes not in the partial
transcript.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 23:06:27 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


In Blaikie's transcripts, i.e., Jack Campin's list, and not previously
known to be in Blaikie's MSS of 1683, or 1692.The Capita me: Blaikie transcript
Montrosse March; Blaikie transcript
Bonnie Lassie; Blaikie transcript
Song with text [Ye woods and groves and purling streams]; Blaikie
transcriptMany others are known from the Wighton partial transcript.
For the ones which have (and where) and which haven't been
reprinted see file SCOTMS.HTM on my website. Just updated, where
'Blaikie transcript' denotes those in Jack's list.Many ot the tunes are familiar under later titles, e.g., Woman's work is
never done (also in Lyden MS) is later The Black Eagle; Jock the laird's
brother is Auld Rob Morris (both tune and person); Montrose Lynes is
I'll never love the more=[Scottish] Chevy Chase, etc.Bruce Olson

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 21:28:46 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(207 lines)


Jack:This is very valuable, especially as it early dates the tunes given.  Motherwell printed some of the tunes, but is there any effort afoot to print the entire manuscript?Can it be copied/Xeroxed/scanned?Ed----- Original Message -----
From: Jack Campin <[unmask]>
Date: Wednesday, September 10, 2003 4:58 pm
Subject: Blaikie MS (NLS MS.1578)> > Jack, how about giving us a title list of the tunes in Blaikie's MS?
> > Not all the tunes Blaikie collected got into Motherwell's appendix,
> > and these are among the earliest Scots traditional tunes. (Also C. K.
> > Sharpe's tunes which I know you've seen).
>
> There is more than one C.K. Sharpe MS, which do you mean?
>
> Here's Blaikie as requested...
>
> Blaikie MS (MS.1578)
>
> MS has the tunes numbered, but some alternate sets or nameless tunes don't
> get numbers.  The owner who did the pencil annotations (William Motherwell?)
> renumbered them all. Pencil notes are in (...) parentheses, my notes are in
> [...].
>
> To Sir Walter Scott/ of Abbotsford Bart./ from his most obedient/ and very
> humble servant/ Andw. Blaikie/ 27. July 1824. [pencil note in Murdoch
> Henderson's writing: "1822 paper",  but I can't see any watermarks]
>
> 1  Sweet Willie
> -  Sweet Willie - a different sett
> 2  The bonny brow or In January last
> 3  Jocky wed a owing go
> 4  Jockie went to the wood or Jockie went too
> 5  Jockie drucken bauble
> 6  Ballou
> 7  Honest Lucky
> 8  Drumlanrick's Air
> 9  The lad's gane
> 10 Jock the Laird's brother
> 11 Bonie Nanie
> 12 The Capita me
> 13 Women's work will never be done
> 14 The Beed to me
> 15 Abbay hills Rant
> 16 Hiland Ladie
> 17 Put up thy dagor Jennie
> 18 My Lady Errol's Lament
> 19 My Lady Monteith's Lament
> 20 Montrose Lynes
> 21 Montrosse March
> 22 Bonnie Lassie
> 23 Bonny Christon
> 24 Lady Binney's Lilt
> 25 New Corn rigs
> 26 Mack Beth
> 27 Franklin is fled far away
> 28 Song with text [Ye woods and groves and purling streams]
>
> [Blaikie's note at this point:] The foregoing 28 tunes are taken
> from two M.S. books bearing date 1683 and 1692.
>
> 29 [untitled]
> 30 Go to the windward my love (Beautiful)
> 31 And when we part we'll meet again (pretty)
> 32 The cruel Father (pretty)
> 33 There came a Maid (pretty)
> 34 [untitled] (pretty)
> 35 [untitled]
> 36 [untitled] (pretty)
> 37 Johnie of Airlegreen
> 38 Our Jean's aye in the right o't
> 38 [untitled]
> 40 A Lady walking in her garden (very nearly the same with ance crowdie
> twice crowdie)
> 41 [untitled] (this seems a dancing tune)
> 42 O will ye marry my daughter Janet
> 43 The silly bit chicken cast it a pickle and it will grow mickle and it
> will do gude
> 44 The Douglas Tragedy
> 45 [untitled] (I have heard the Broom of the Cowdenknows sung
>               to this No.45. In Smith's collection May Colvin)
> 46 [untitled] (pretty)
> 47 [untitled] (ordinary)
> 48 Kate Carnagie
> -  A different set of Kate Carnagie
> 49 Matthew Malone (is this not Irish by its name?)
> 50 The clairty Cook of Torwoodlee (the same as Elsey Marlie)
> 51 The three Maries (not pretty, & vulgar)
> -  The three Maries - a little different (do.)
> 52 The Lass of Lochryan (not nearly so good as the common one)
> -  The poor man's labour's never done
> 53 The Knight in Jessemont (not ugly)
> 54 Bonny Billie (The battle of Bothwell Brigg)
> 55 The King of Fairies or The Roses they smell sweetly (Lord Maxwell's
> goodnight)-  The King of Fairies  a different set
> 56 Little Jock Elliot or Whae dare meddle wi' me
> 57 The Jew's daughter (very pretty & will do for some other ballad)
> 58 Lady Margerie (almost the same as Lammikin & will serve as 2. part to
> it & prevent monotony)
> 59 Drowzy Lane
> 60 Young Essex (very pretty)
> 61 Taffy or Irae Corona
> 62 Earl Landale (set in vol 1st)
> -  Lord Ingram - a slight variation of the above (2d. part to the above)
> 63 Thomas the Rhymer (set already in Vol 1st. of Ballads)
> 64 The Mill dams of Binnorie (Set in Vol. 1st. after the other tune)
> 65 Oxter my Lassie
> 66 Awake my fairest creature
> 67 The French Gallerie O (is this not English. Words wanted)
> 68 Earl Aboyne or Peggy Irvine
> 69 The Lochmaben Harper (set already)
> 70 Brinny O Linn (Irish?-)
> 71 Earl Aboyne
> 72 Dysmal
> 73 When first I came to Edinburro
> 74 Niddlety noddlety
> 75 Lord Johnny Scott (a little different from our set of John the Little
> Scott)76 Janet of Carterhaugh (not so good as our own set)
> 77 Duncan Swan
> 78 Fause Foodrage (mainly the same with ours)
> 79 Argyle's Courtship
> 80 Sally Green
> 81 [untitled] (very pretty and likely to have a relationship to No. 85
> opposite)82 I'll dye my Ribbons
> 83 Hey burdy croon
> 84 There was a youthful Lawyer
> 85 Born in St. Johnstone & burn'd in Dundee (very beautiful, Q. are
>                                             the words fit & to be had)
> 86 Love will find out the way
> 87 The winter it is past and the summer's come at last (pretty)
> 88 Thus I gain'd my pretty fair maid (same tune as There was
>                                      a Lawyer & a sawyer)
> 90 The wee wedding
> 91 The wee wedding
> 92 The fit's come o'er me now
> 93 [untitled] (pretty I think)
> 94 Robin Hood & the Beggar (What are the words. The tune seems good.)
> 95 Cock Robin's Testament (chorus words of this wanted)
> 96 Cock Robin's Testament - a different air
> 97 Rosanna - In Oxford lived a Lady fair
> 98 The cruel Father (pretty. same as No. 33)
>   [note in Murdoch Henderson's writing: same
>    treble but different bass from no. 33]
> 99 The Spanish Lady (a queer tune. what are the words)
> 100 O what a foolish Girl was I
> 101 He chac'd me to my Daddie's door
> 102 Good Lord Scroope alias Hughie Graham (not so pretty as our own set)
> 103 The Weaver Lad
> 104 The Ramalies (not ugly)
> 105 Lambkin
> 106 King William going out a hunting (pretty. what words?)
> 107 Ye sit in the sun sae louzy
> 108 When I was a young man
> 109 It fell upon a certain day
> 110 A Lady walking in her garden (not ugly)
> 111 The three Maries (very pretty for 2nd. part v. the other book p.1)
> 112 The King & the Tinker (pretty)
> 113 Go fetch me Lord Thomas (not ugly - what words has it?)
> 114 [untitled] (pretty)
> 115 The land of fair Virginia O (not unlike the other but the
>                                 common one is [?] this magic [?])
> 116 Johnnie Armstrong (neither of these so pretty as our own I think)
> 117 Johnnie Armstrong - a little different from the above
> 118 [untitled]
> 119 A penny worth of wit
> 120 [untitled]
> 121 And a begging we will go
> 122 My bosom burns
> 123 Herd the Cows
> 124 Gude e'en to ye auld man
> 125 Katie Scroggie
> 126 Earl of Crawford (not ugly)
> 127 Johnny of Braidislee (mainly the same as our own but not so good)
> 128 Tammas has ridden & Tammas has run
>
>
> And here's the other tune for comparison...
>
> X:1
> T:untitled no.81
> S:NLS MS.1578
> Z:Jack Campin 2003
> M:3/4
> L:1/4
> K:E Minor
> B,|E  G F/E/|F d ^c| B    G  F/E/|FD \
> B,|E  G F/E/|F d ^c| B/A/ G  F   |E2||
> B |d ^c B   |e B  d|^c    B  G   |FD \
> B,|d ^c B   |e B  A| B    e ^d   |e2
> B |d ^c d   |e B  d|^c    B  G   |FD \
> B,|E  G F/E/|F d ^c| B/A/ G  F   |E2|]
>
>
> ---------------------------------------------------------------------------
> --
> Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
> <" target="l">http://www.purr.demon.co.uk/jack>     *     food intolerance
> data & recipes,
> Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
> ---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <-
> --
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Wed, 10 Sep 2003 21:49:01 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


Folks:Bruce and Jack's wexchanges lead me to ask if there is any "history" of Anglo-Scots-Irish folksong collection comparable to Dorson's _The British Folklorists?_  Hustvedt's _Ballad Books and Ballad Men_ is good, so far as it goes, but one Andrew Blaikie is not listed in the index.Ed----- Original Message -----
From: Bruce Olson <[unmask]>
Date: Wednesday, September 10, 2003 8:06 pm
Subject: Re: Blaikie MS (NLS MS.1578)> In Blaikie's transcripts, i.e., Jack Campin's list, and not previously
> known to be in Blaikie's MSS of 1683, or 1692.
>
> The Capita me: Blaikie transcript
> Montrosse March; Blaikie transcript
> Bonnie Lassie; Blaikie transcript
> Song with text [Ye woods and groves and purling streams]; Blaikie
> transcript
>
> Many others are known from the Wighton partial transcript.
> For the ones which have (and where) and which haven't been
> reprinted see file SCOTMS.HTM on my website. Just updated, where
> 'Blaikie transcript' denotes those in Jack's list.
>
>
> Many ot the tunes are familiar under later titles, e.g., Woman's work is
> never done (also in Lyden MS) is later The Black Eagle; Jock the laird's
> brother is Auld Rob Morris (both tune and person); Montrose Lynes is
> I'll never love the more=[Scottish] Chevy Chase, etc.
>
> Bruce Olson
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 08:09:40 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


> This is very valuable, especially as it early dates the tunes given.
> Motherwell printed some of the tunes, but is there any effort afoot
> to print the entire manuscript?Not unless I do it, I guess.  I had in mind publishing a few Scottish
MSS on CD-ROM using the same technology I've already used, but hadn't
thought of this one; it would be a couple of weeks' work and only
feasible if I could find some funding for it, as it's hardly going to
sell in huge numbers.> Can it be copied/Xeroxed/scanned?Yes, but it won't be cheap.  There are microfilms about; these will
lose the pencil annotations (you've got my transcriptions of them,
anyway) but the music calligraphy is clear enough for microfilming,
the binding lies flat, and I don't remember seeing a single correction
or ambiguous pitch that might need close-up physical examination to
sort out.www.nls.uk will give reprographic prices somewhere.  Since they've
already microfilmed it, second-generation copies might be cheaper.-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: anybody seen this elsewhere?
From: Jack Campin <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 08:19:01 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(134 lines)


From the NLS Glen.370 copy of James Porteous's "A Collection of Strathspeys,
Reels & Jigs, Respectfully Dedicated to Lady Jardine of Applegarth"
[Edinburgh, 1822]; this copy has "Applegarth" handwritten on the titlepage
so it must have belonged to the family that sponsored it.Porteous not only dedicated tunes in this collection to remote members
of the Jardine family with quite extraordinary obsequiousness, he also
wrote a tune to commemorate his namesake deservedly hanged in the riot
of 1737.  There is a tune of his in this book called "The Old Spedling
Castle Ghost's Dance", relating to the legend below.  These two bits of
paper were inserted much later, though.Newspaper clipping (dated on back, Evening News, 6th July [1953? - illegible]:A Dumfriesshire Ghost Story
===========================Spedlin's Tower, a grim old castle in Dumfriesshire, on the southwest bank
of the Annan, is the scene of a ghost story of great local fame, and
supported by excellent traditional authority.  In the time of Charles II,
Sir Alexander Jardin confined in the dungeon of this castle a miller named
Porteous, who was suspected of arson.  Absentmindedly carrying off the
keys of the vault, the miller was starved to death.  No sooner was he dead
than his ghost began to torment the household.  But Sir Alexander procured
a black-letter Bible, and so long as that remained in the house the ghost
could not move out of the vault where Porteous had died.  Here its screams
were frequently heard at night.  "Let me out, let me out," it would cry,
"for I'm dyin' o' hunger."  When the family repaired to a newer mansion,
Jardine Hall, on the other side of the river, the Bible was left behind to
keep the restless spirit in order.  Once, however, it was sent to Edinburgh
to be rebound, when the ghost crossed the river, and played such mad pranks
in the new house - pulling the lord and lady out of bed, &c. - that the
Bible was recalled at once.  Early in the present century, however, the
Bible was taken to Jardine Hall without any unpleasant circumstances.Ballad in probably-early-20th-century writing on paper of probably the
same age:The Prisoner of Spedlins
========================To Edinburgh, to Edinburgh,
The Jardine he maun ride;
He locks the gates behind him,
For lang he means to bide.And he, nor any of his train,
While minding thus to flit,
Thinks of the weary prisoner,
Deep in the castle pit.They were not gane a day, a day,
A day but barely four,
When neighbours spoke of dismal cries,
Were heard frae Spedlins Tower.They mingled wi' the sigh of trees,
And the thud-thud o' the lin;
But nae ane thocht 'twas a deein' man
That made that eldritch din.At last they mind the gipsy loon
In dungeon lay unfed;
But ere the castle key was got,
The gipsy loon was dead.They found the wretch stretch'd out at length
Upon the cold cold stone,
With starting eyes and hollow cheek,
And arms peeled to the bone!----------------------------------Now Spedlins is an eerie house,
For oft at mirk midnight
The wail of Porteous' starving cry
Fills a' that house wi' fright.'O let me out, o let me out,
Sharp hunger cuts me sore;
If ye suffer me to perish so,
I'll haunt you evermore!'O sad sad was the Jardine then,
His heart was sorely smit;
Till he could wish himself had been
Left in that deadly pit.But, "Cheer ye,' cried his lady fair,
'Tis purpose makes the sin;
And where the heart has had no part,
God holds his creature clean.'The Jardine sought a holy man
To lay that vexing sprite;
And for a week that holy man
Was praying day and night.And all that time in Spedlins house
Was held a solemn fast,
Till the cries waxed low, and the boglebo
In the deep Red Sea was cast.----------------------------------There lies a Bible in Spedlins ha',
And while it there shall lie,
Nae Jardine can tormented be
With Porteous' starving cry.But Applegarth's an altered man -
He is no longer gay;
The thought o' Porteous clings to him
Unto his dying day.It maybe isn't too surprising that this wasn't anthologized down
the ages, but has anybody seen *any* reference to it elsewhere?
Or any other ballad on the same legend?  (I was talking to Roddy
Martine a while ago about haunting traditions in Scotland - he's
just published a book about present-day experiences of ghosts -
and he'd never heard of this yarn, which for somebody with his
connections to the Scottish landed gentry is saying something).Is the Red Sea noted as a sort of Sellafield for boglebos?  And
if so why don't they stay put after being reprocessed by holy men?-----------------------------------------------------------------------------
Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
<http://www.purr.demon.co.uk/jack>     *     food intolerance data & recipes,
Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <---

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 07:21:39 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(21 lines)


Bruce Olson wrote:
>
> In Blaikie's transcripts, i.e., Jack Campin's list, and not previously
> known to be in Blaikie's MSS of 1683, or 1692.
>
>Blaikie's MSS of 1683 and 1692 were said to have much the same contents,
and Blaikie is said to have lost the earlier one.
Ballad-Lers in England. Anyone got any ideas about where to look for Wm.
Chappell's partial transcript of the Blaikie MS of 1692?
Chappell said the MS contained the tune "God Save The King", of which
there's no mention in any other commentary on the MS.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 09:20:43 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


Let's be blunt. There are a few traditional tunes scattered here
and there before Andrew Blaikie's time, but Andrew Blaikie was
the first to systematically collect traditional tunes for songs
and ballads in the English language. The greater part that he
collected have not yet been published.Now off to [EASMES's] Kate Van Winkle Keller's home for a discussion.
I no sooner find that she lives nearby than she plans to move
away.I'm hoping that she can point out (via an unpublished thesis) a
translation to modern musical notation of "The Gaberlunzie Man"
in the Balcarres MS, c 1700. That would put song and tune to c
1700, earlier than now known. Blaikie's old MSS didn't have it
(nor does Leyden MS, 1692) as far as we know.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 08:45:17 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(44 lines)


Folks:I wonder how many list members might join me in underwriting a portion of Jack's expenses/time.  He has access to manuscripts most of us would otherwise never see.Ed----- Original Message -----
From: Jack Campin <[unmask]>
Date: Thursday, September 11, 2003 0:09 am
Subject: Re: Blaikie MS (NLS MS.1578)> > This is very valuable, especially as it early dates the tunes given.
> > Motherwell printed some of the tunes, but is there any effort afoot
> > to print the entire manuscript?
>
> Not unless I do it, I guess.  I had in mind publishing a few Scottish
> MSS on CD-ROM using the same technology I've already used, but hadn't
> thought of this one; it would be a couple of weeks' work and only
> feasible if I could find some funding for it, as it's hardly going to
> sell in huge numbers.
>
>
> > Can it be copied/Xeroxed/scanned?
>
> Yes, but it won't be cheap.  There are microfilms about; these will
> lose the pencil annotations (you've got my transcriptions of them,
> anyway) but the music calligraphy is clear enough for microfilming,
> the binding lies flat, and I don't remember seeing a single correction
> or ambiguous pitch that might need close-up physical examination to
> sort out.
>
> www.nls.uk will give reprographic prices somewhere.  Since they've
> already microfilmed it, second-generation copies might be cheaper.
>
> ---------------------------------------------------------------------------
> --
> Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131 6604760
> <" target="l">http://www.purr.demon.co.uk/jack>     *     food intolerance
> data & recipes,
> Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro, Embro".
> ---> off-list mail to "j-c" rather than "ballad-l" at this site, please. <-
> --
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Paul Stamler <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 11:40:58 -0500
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


----- Original Message -----
From: edward cray <[unmask]><<I wonder how many list members might join me in underwriting a portion of
Jack's expenses/time.  He has access to manuscripts most of us would
otherwise never see.>>Yup. Can't do much but I'll do what I can.Peace,
Paul

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Cal & Lani Herrmann <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 10:34:17 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(14 lines)


On Thu, Sep 11, 2003 at 11:40:58AM -0500, Paul Stamler wrote:
> ----- Original Message -----
> From: edward cray <[unmask]>
>
> <<I wonder how many list members might join me in underwriting a portion of
> Jack's expenses/time.  He has access to manuscripts most of us would
> otherwise never see.>>
>
> Yup. Can't do much but I'll do what I can.        And me too, please -- Aloha, Lani<||> Lani Herrmann * [unmask] (or: [unmask])
<||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Key of the Cellar
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 14:35:40 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


I mentioned "Key of the Cellar/Bob and Joan" here in a recent post.
{In a reply to John Garst on indicted timing ans which notes were stress
notes)Thanks to Kate Van Winkle Keller for the loan of a xerox of a
manuscript, below is an ABC of the earliest known copy of it.
The bawdy "Rakes of Stoney Batter" which gave the tune it most
popular title after c 1775, "Bob and Joan", is in the Scarce
Songs 1 file on my website. In the Irish tune index on my website
are some other titles for the tune, but they don't take us to
songs to the tune, like Samuel Woodworth's "Patriotic Diggers",
and a school song, if I remember correctly, of Amherst.Sorry, the dance directions can't be clearly seen on the xerox copy, and
aren't given here.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 14:43:09 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(39 lines)


Bruce Olson wrote:
>
> Let's be blunt. There are a few traditional tunes scattered here
> and there before Andrew Blaikie's time, but Andrew Blaikie was
> the first to systematically collect traditional tunes for songs
> and ballads in the English language. The greater part that he
> collected have not yet been published.I may have gone a bit overboard here, Can any of the English Ballad-L
subscribers tell when the Rev. John Broadwood started collecting
traditional tunes. First published in 1843 if I remember correctly.> Now off to [EASMES's] Kate Van Winkle Keller's home for a discussion.
> I no sooner find that she lives nearby than she plans to move
> away.
>
> I'm hoping that she can point out (via an unpublished thesis) a
> translation to modern musical notation of "The Gaberlunzie Man"
> in the Balcarres MS, c 1700. That would put song and tune to c
> 1700, earlier than now known. Blaikie's old MSS didn't have it
> (nor does Leyden MS, 1692) as far as we know.
>
> Bruce OlsonModern musical notation of "The Gaberlunzie Man" from Balcarres MS now
in hand, from Kate Van Winkle Keller.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
> and broadside ballads at my no-spam website
> <A href="http://www.erols.com/olsonw"> Click here for homepage (=
> subject index) </a>--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 14:52:21 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


Cal & Lani Herrmann wrote:
>
> On Thu, Sep 11, 2003 at 11:40:58AM -0500, Paul Stamler wrote:
> > ----- Original Message -----
> > From: edward cray <[unmask]>
> >
> > <<I wonder how many list members might join me in underwriting a portion of
> > Jack's expenses/time.  He has access to manuscripts most of us would
> > otherwise never see.>>
> >
> > Yup. Can't do much but I'll do what I can.
>
>         And me too, please -- Aloha, Lani
>
> <||> Lani Herrmann * [unmask] (or: [unmask])
> <||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360I'll help with a bit of money, and as much as I'd like to go back to
Edinburgh (or Newton Grange) to do more, (and get into these Panmure MS
now at NLS) I can't manage that.Panmure MSS (17th an 18th century English and Scots tunes) are
microfilmed and these are supposedly available individually via NLS
website (but not yet tracked to order page) and, in toto with many other
early Scots MS are available from a commercial supplier. Thanks to Kate
Van Winkle Keller, I got her spare microfilm/microfiche reader this
morning, so now I can see a microfilm.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: O'er the Moor among the Heather
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 15:27:04 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(28 lines)


The ABC below is apparently the original tune for a widely known
song under variety of titles. Jean Redpath's "Skipping Barfoot
through the Heather" is the earliest I remember hearing, then a
version sung by Delia Murphy.
It's Steve Roud's #375, and he cites broadside texts and
traditional ones. It's been widely known in Scotland [Greig-
Duncan], Ireland [Sam Henry coll'n +..], Canada, and less common
in the USA. If I remember correctly, Bertrand Bronson even has a
few traditional versions added as variants of a Child ballad, in
'Traditional tunes of the Child Ballads'. [Loan of MS by Kate Van Winkle
Keller]X:1
T:O'er the Muir Among the Heather
S:David Young MS, 1740. Bodleian MS Don. d.54
Q:1/4=120
L:1/8
M:C|
K:G
DEGA GAGD|EGAB ABAE|GABG ABde|dBgB ABAG:|\
G g2 a gagd|e2a abag|bage degd|(e/f/g) Bg ABAG:|]Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Key of the Cellar
From: Cal & Lani Herrmann <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 13:54:26 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


On Thu, Sep 11, 2003 at 02:35:40PM -0400, Bruce Olson wrote:
> I mentioned "Key of the Cellar/Bob and Joan" here in a recent post.
> {In a reply to John Garst on indicted timing ans which notes were stress
> notes)
>
> Thanks to Kate Van Winkle Keller for the loan of a xerox of a
> manuscript, below is an ABC of the earliest known copy of it.
> The bawdy "Rakes of Stoney Batter" which gave the tune it most
> popular title after c 1775, "Bob and Joan", is in the Scarce
> Songs 1 file on my website. In the Irish tune index on my website
> are some other titles for the tune, but they don't take us to
> songs to the tune, like Samuel Woodworth's "Patriotic Diggers",
> and a school song, if I remember correctly, of Amherst.
>
> Sorry, the dance directions can't be clearly seen on the xerox copy, and
> aren't given here.        Sorry back, Bruce, but there is NOTHING (no ABC or anything else)
        in your message.  ??? -- Aloha, Lani<||> Lani Herrmann * [unmask] (or: [unmask])
<||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Key of the Cellar
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 19:25:47 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(38 lines)


Cal & Lani Herrmann wrote:
>
>
>         Sorry back, Bruce, but there is NOTHING (no ABC or anything else)
>         in your message.  ??? -- Aloha, Lani
>
> <||> Lani Herrmann * [unmask] (or: [unmask])
> <||> 5621 Sierra Ave. * Richmond, CA 94805 * (510) 237-7360Sorry, I shouldn't have renamed the file after I copied the ABC onto the
header text, because I sent only the header.The ABC below is apparently the original tune for a widely known
song under variety of titles. Jean Redpath's "Skipping Barfoot
through the Heather" is the earliest I remember hearing, then a
version sung by Delia Murphy.
It's Steve Roud's #375, and he cites broadside texts and
traditional ones. It's been widely known in Scotland [Greig-
Duncan], Ireland [Sam Henry coll'n +..], Canada, and less common
in the USA. If I remember correctly, Bertrand Bronson even has a
few traditional versions added as variants of a Child ballad, in
'Traditional tunes of the Child Ballads'.X:1
T:O'er the Muir Among the Heather
S:David Young MS, 1740. Bodleian MS Don. d.54
Q:1/4=120
L:1/8
M:C|
K:G
DEGA GAGD|EGAB ABAE|GABG ABde|dBgB ABAG:|\
G g2 a gagd|e2a abag|bage degd|(e/f/g) Bg ABAG:|]--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Not Ay Waukin O
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 20:31:27 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(34 lines)


The song "Jess Macfarlane" was printed in Napier's 'Scots Songs' in
1794. The tune there was a version of "Ay Waukin O" that I don't
have.
C. K. Sharpe said she was an Edinburgh beauty of about
1740. She can't be later, given the tune below. This song, an extended
version of "Ay Waukin O",  can be found in the Scare Songs 1 file on my
website. If we threw a piles of slurs into the tune below, we might get
a fit to the verses.The early tune, below, presumeably for some song about her, however,
doesn't seem to be "Ay Waukin O". This leaves us with more problems
concerning it's tune history than we started with. Is there
another song of Jess Macpharlane that we haven't heard about?
[Typical of real research.]X:1
T:Jess Macfarlane
S:David Young MS, 1740. Bodleian MS Don. d. 54
N:from xerox copy of Kate Van Winkle Keller
Q:1/4=120
L:1/8
M:C
K:D
e|fA A/A/A "tr"e3/2d/2Be|fA A/A/A "tr"e2 de|\
fA A/A/A "tr"e3/2d/2Be|aedf "tr"e2e:|\
e|fdef "tr"d3/2d/Be|fdfd "tr"e2 de|fdfd "tr"e3/2dBe|\
aefd "tr"e2d:|]Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Andre Blaikie's tradition tunes #1
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 21:01:43 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(30 lines)


Andrew Blaikie's "Franklin is fled away":
From NLS MS Adv 5.3.4 (c 1650-55). 6 verses of which I copied
only the first:FrankenWho shall now grace our pladnes[?], oh hone, oh hone
Or teach love by sadness the Swaines
Since ffrankin's fled away, the fower of yt May
Who can but Sadly say, oh hone, oh hone.From the broadside ballad index on my website:
Frankin my loyal friend, O hone, O hone/ ZN916| A mournful Carol
..Frankin and Cordelia/ Tune: Franklin is fled away/ P2  76 = RB7
418: M. Coles, VWCTP// Tune: Frankin is fled away/ DC2  221b: Wm.
Gilbertson [BC2 69] [Entered 1656. ZB1823|, Expansion  of six
verse song in NLS MS Adv. 19.3.4, f. 19v, where name is  Frankin,
not Franklin. ?Answer, N916|] [search for 'Franklin is fled' in
my broadside ballad index to see how popular the tune was]
Simpson's tune in BBBM is given as B146 among the broadside
ballad index on my website. Needless to say non-Scots knew nothing of
the Scots text or tune.Bruce Olson--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Blaikie
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 21:13:14 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(9 lines)


Sorry, that last post or mine had Subject: traditional tune,
which was wrong. It' a Blaike MS tune.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Blikie's traditional tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 22:28:15 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(58 lines)


Blaikie's traditional tunes. Here are some of the easy ones:ZNnnnn are listing numbers in the broadside ballad index on my
website. BBBM means early tune is in Simpson's 'The British
Broadside Ballad and It's Music', and as an ABC on my website.86 Love will find out the way: Over the Mountains/ ZN2200 Truths
Integrity/ Tune: Love will  find out the Way. To a pleasant new
tune/ E 358: CWVG/ RB2 639:  F. Coules/ RWL 189: CVW/ DC2 232a:
E. C for CVW [Entd. very late, 1656, 1675. ZB2745|, ZB2746|.
Answer entered 1633, ZB81|] Tune very popular. BBBM95 Cock Robin's Testament (chorus words of this wanted);
96 Cock Robin's Testament - a different air:
"Robin's Testament". From Herd's 'Scots Songs', 1776, to multiple
traditional versions in Greig-Duncan, vol. 397 Rosanna - In Oxford lived a Lady fair: ? O where's my Rosinda?
shall I never more/ ZN2063| The two Unfortunate Lovers..[Almander
and Rosinda] Traditional versions usually name her Rosanna. Roud
#788, Laws M30.99 The Spanish Lady (a queer tune. what are the words)
Will you hear a Spanish Lady/ ZN2935| The Spanish Ladies Love/ a
Pleasant New Tune/ [by T. Deloney?]/ P3 148: CTP/ E 340 = WE25  11:
CVG/ P5B 26: TP/ OPB 219: W. O./ DC2 211b: CVW/ RB6 655:   [no
imprint]/ CR 1351 = Frb.19(25): W. O and A. M. and sold by  J.
Conyers/  CR 1352: Bow-Church-Yard/ CR 1353: Aldermary
Church-Yard/ CR 1354: J. Butler, Worcester [c 1750]// Tune:  Flying
Fame/ DC2 210a: T. Norris/ 'Garland of Goodwill', Mann's  'Deloney'
[DC3 84v, BC1 48, BC2 36] [Entd. June 11, 1603, 1624,  1675.
ZB2509|, ZB2508|, ZB2510|] [COB2 191] Simpson's BBBM tune from NLS,
MS Adv. 5.2.15 (Skene MS), which I have seen.106 King William going out a hunting (pretty. what words?)
1: Old stories do tell us of notable things/ ZN2140| The Royal
Recreation..King William's. Entertainment at a Country Farmer's
House/ Tune: Let Caesar live long/ Licensed according to Order/  P2
312 = CR 967: BDBB [Ptd. RB7 759] [Answer commences "The  most
Royal frollick," N1778|, N1779|. Almost identical to that here is
'The Royal Frolic,' commencing "Old stories inform us of Jocular
things," N2141|] BBBM
2: Old Stories inform us of Jocular things/ ZN2141| The Royal
Frolick. King William.. Entertainment at the Farmers House/  Tune:
Let Caesar live long/ Licensed according to Order/ P2  313: J.
Millet [Ptd. RB7 756] [Almost the same as 'The Royal Recreation,'
commencing "Old stories do tell us of  notable things," ZN2140. The
answer to the Royal Frolick commences "The most Royal Frolick of
our Great King," N1778|, 1779] BBBM119 A penny worth of wit:? Here is a pennyworth of Wit/ ZN1132| ABruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: dick greenhaus <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 23:04:11 -0400
Content-Type:multipart/alternative
Parts/Attachments:
Parts/Attachments

text/plain(21 lines) , text/html(31 lines)


Sorry, your browser doesn't support iframes.


Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blikie's traditional tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 23:26:47 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(29 lines)


Bruce Olson wrote:
>
> Blaikie's traditional tunes. Here are some of the easy ones:
>
Add:
99 Spanish Lady 1:  Roud #9735.Other possibilities, but I thank Blaikie's date of c 1827 is maybe too
early for them.Spanish Lady 2: As I was upon the way/ ZN254| Denying Lady/ Tune:
I [Aye] marry and thank you too [meaningless music printed]/
Licensed according to Order/ P5 248: A. Milbourn. BBBM. Original
of traditional "Spanish Lady/ Spanish Merchant's Daughter", Roud
#146 (but one apparently listed as #542)Spanish Lady 3: in Grieg-Duncan, IV, #746. Roud #542 (but one
apparently listed as #146)Add:
to 95/6 Robin's testament: Roud #3900
to 86 Love will find out the way: Roud #13167Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Not Ay Waukin O
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 23:53:37 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


Bruce Olson wrote:> X:1
> T:Jess Macfarlane
> S:David Young MS, 1740. Bodleian MS Don. d. 54
> N:from xerox copy of Kate Van Winkle Keller
> Q:1/4=120
> L:1/8
> M:C
> K:D
> e|fA A/A/A "tr"e3/2d/2Be|fA A/A/A "tr"e2 de|\
> fA A/A/A "tr"e3/2d/2Be|aedf "tr"e2e:|\
> e|fdef "tr"d3/2d/Be|fdfd "tr"e2 de|fdfd "tr"e3/2dBe|\
> aefd "tr"e2d:|]
> Bruce OlsonThe tune 'Jess Macfarlane", 1740, may have been just a dance tune
named in her honor, so I'm not searching for another song about her.The dance of 1740:SETT and cast down the first Couple, Sett and cast down High[?]
Lead up to the head, and cast down the first Couple again. SETT
cross Partners. Four hands around, then right and left.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Thu, 11 Sep 2003 23:57:10 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(11 lines)


dick greenhaus wrote:
>
> Me too (if the bite isn't too severe.)
> dick greenhaus
>
>Jack, sorry if my request for a list of Blaikie's traditional tunes got
you into more than you can handle.Bruce Olson

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blikie's traditional tunes
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 01:20:09 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(31 lines)


Bruce Olson wrote:
>
> Blaikie's traditional tunes. Here are some of the easy ones:
>
> 106 King William going out a hunting (pretty. what words?)
> 1: Old stories do tell us of notable things/ ZN2140| The Royal
> 2: Old Stories inform us of Jocular things/ ZN2141| The Royal
>Whoops, got wrong King William ballad, he's not hunting in the
ones I gave reference to above.106 King William going out a hunting (pretty. what words?)
1: You subjects of Britain come listen a while/ ZN3107| .. King
William And his Forrester/ Tune: its own proper Tune/ CR 1421:  [no
imprint, c 1690-94] [Another version, "You subjects of  England,"
N3108| Roud #853]
2: You subjects of England come listen a while/ ZN3108| The Loyal
Forrister, Or, Royal Pastime/ Tune: Excellent New Tune/ E 156:  C.
Bates// The King and the Forrester/ Tune: [none indicated]/  RB7
763: [white letter, no imprint] [See "You subjects of  Britain,"
N3107|, Roud #853] He's a Keeper in Frank Purslow's 'Marrow Bones',
p. 49--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Braes of Balquither: Evolution in 200 + years
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 03:42:00 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(115 lines)


How do we get from the first tune below to Francis McPeake's
"Will you go lassie go"? Evolution.X:1
T:The Braes of Balquhidder
S:David Young, 1740. Bodleian MS Don. d.54
Q:1/=120
L:1/8
M:C|
K:Aphrygian
c2|(A/c/d) Fc A2 Ac|(A/c/d) Fc AGGc|\
dFcF A2 Ac|defc A/A/A A:|\
c|defc A/A/A ag|fd"tr"cA cGGc|defd "tr"cAag|\
a/g/f/e/ fc A/A/A Ac|def A/A/A ag|\
fd"tr"cA cGGA|FCC FGAa|(agfe f)c A2A:|]Here's what Jack Campin discovered, song and tune:The Braes o' Bowhether.Now the day's growin' lang lass,
an' sweet shines the weather,
an' we'll owre a' the hills,
to the Braes o' Bowhether.
Amang the Glens an' Rashy dens,
I'll prize thee without measure,
Within my arms, wi' a' thy charms,
I'll clasp my lovely treasure,
In sweetest Love, our time will move,
wi' mair than earthly pleasure;
By the little limpid streams,
On the Braes o' Bowhether.An' I'll ay loe thee dearly,
Ilk day wes' forgather,
Syne we'll row on the fog,
By the Braes o' Bowhether;
To Pipe or Flute, when time will suit,
We'll dance like ony feather,
An', skip the knowes where Claver grows,
Or stray amang the Heather;
Ay free frae strife in sic a life,
There, weary shall we never,
By the limpid little streams,
On the Braes o' Bowhether.X:2
T:The Braes o' Bowhether
S:John Hamilton, 24 Scots Songs, 1796
N:H is not standard ABC yet; it means a fermata, sic-
N:bars 6 and 8 are too long (2nd to last notes length 2 instead?)
Z:Jack Campin
Q:1/4=120
M:C
L:1/8
K:F
"Slow"
A/ c/|d2 F> G A A> z c| d2  F> G A <G z/(G/A/)c/|\
d2 F> G| (AG) A> c|(d>e)  f> d   (c/A/  A2)   ||\
c |d> e f d c> A a> g| f d  c> A  (A/G/) G3 c/|\
d> e f  d   c> A a> g| f> e (d/e/) (f/d/) (c/A/) A3 c/|\
d> e f  d   c> A a> g| f> d (d/c/) (B/A/) (A/G/) G2   A/G/|\
F> D C> D  (F>G)  A> c|(d>e) (g/f/) (e/d/) (c/A/  A2)  |]Robert Tannahil seems to have known a bit of the old song, but
not it's tune. From Graham's 'Songs of Scotland' we get
Tannahill's "The Braes of Balquhidder'Will you go lassie, go,
To the Braes o' Balquhidder?
Where the blaeberries grow,
'Mang the bonnie bloomin' heather;
Where the deer and the rae,
Lightly bounding together,
Sport the lang summer day
'Mang the braes o' Balquhidder,
[Cho:] Will you go lassie go,
To the braes o' Balquhidder?
Where the blaeberries grow,
'Mang the bonnie bloomin' heather.[3 more verses]Graham said the tune was in Capt. Fraser's 'Highland Melodies',
1816, #77, with slight differenes from that (later) in R. A.
Smith's 'Scottish Minstrel' I, p. 49 (I don't have).Capt. Fraser's is:Bochuidear      Balquhidder. As performed by Major LoganX:3
T:Bochuidear
S:Capt. Fraser's Highland Melodies [reprint]
Q:1/4=120
L:1/8
M:C
K:F
c|{A/c/}d2 F3/2c/ A2 A3/2c/|{A/c/}d2 F3/2c/ AGGc|\
{A/c/}d2 F3/2c/ A2 Ac|d3/2e/{d/e/}f3/2d/ cA A:|\
c|d3/2e/ {d/e/}f3/2d/ c/A3/2 {c/}a3/2g/|\
f3/2c/ d/c/B/A/ AGGc|d3/2e/ {d/e/}f3/2d/ c/A3/2 {c/}a3/2g/|\
f/d3/2) {d/e/}f3/2d/ c3/2A/Ac|\
d3/2e/ {d/e/}f3/2d/ c/A3/2 {c/}a3/2g/|\
f3/2c/ (d/c/)(B/A/) AGG (A/G/)|F3/2E/D3/2E/ F3/2G/A3/2c/|\
d3/2e/ {d/e/}f3/2d/ cAA|]I suspect all here know Francis McPeake's version. I quit here.Bruce Olson
--
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Braes of Balquither: Evolution in 200 + years
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 09:16:58 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


Bruce Olson wrote:
>
> How do we get from the first tune below to Francis McPeake's
> "Will you go lassie go"? Evolution.
>
> X:1
> T:The Braes of Balquhidder
> S:David Young, 1740. Bodleian MS Don. d.54> Bruce OlsonAbove with dance calls of 1740, Tannahill's and McPeake's text given
complete are now in Scarce Song 2 file on my website. ABCs are in S2.ABC
for easier play, and ABC of "Braes of Balquither" from
'Scots Music Museum', 1788, added.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie's traditional tunes fom Jack's list
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 10:42:02 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(33 lines)


Bruce Olson wrote:
>I'm trying to think up a way to make my progress available
without clogging Ballad-L with numerous notes here. The best I've
come up with is make a file on my website, and annouce
'significant' progress. There are a lot of Child ballad tunes
there, that probably can't be tied to any particular text.Some of the odd ones we'll have to rely on Murray Shoolbraid or
Grieg-Duncan collection to figure out, if we're ever going to, that is.30 Go to the windward my love (Beautiful)
If you'll buy 'window' for 'windward', we've got a very old night
visit song. Simpson's BBBM, tune= #162, (ABC on my website) gives
long discussion, mentioning Baskerville's 'Elizabeth Jig', but
Baskerville also wrote an article 'English Songs of the Night
Visit', which I copied many years ago, but forgot to note what
journal it came from. PMLA most likely.74 Niddlety noddlety. Probably "Robin a-Thrush" version of Child
ballad of wife wrapted in wedderskin.87 cold winter Roud #583. Broadsides (Curragh of Kildare) and
traditional (Cold winter...) J. Oswald printed tune in bk 10 of
CPC, c 1759.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie's traditional tunes, proposed identifications
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 11:22:01 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(22 lines)


Now on my website at the end of section 1 is a click-on to file
BLAIKREF.TXT to follow progress in Identifying Andrew Blaikie's
traditional tunes.If you want to propose an identification then email it to me,
and I'll enter it and credit it to you in the file, but please not
all at once.Steve Roud's folksong index doesn't cover printed or manuscript
music sources, so I've entered at #87 the tune titles reference
to "Curragh of Kildare" in my Irish tune index. Search through
Irish tune index file, as it has a nominal cut-off date of 1864
(just before Petrie died) for numbered items, and later items,
like Joyce's 4 verses and tune in OIFMS, and O'Neill's tune in
'Music of Ireland' are further down the file.Bruce OlsonRoots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Ebay Special Alert: Bronson Volume 4!!
From: Dolores Nichols <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 11:54:34 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(16 lines)


Hi!        This appeared this morning. The seller seems to have a lot of
interesting books and I have been watching his listings everyday.        3551384957 - Traditional Tunes of the Child Ballads Vol 4 by
Bronson, 1972, $49 (ends Sep-18-03 19:56:39 PDT)                        Happy Bidding!
                        Dolores--
Dolores Nichols                 |
D&D Data                        | Voice :       (703) 938-4564
Disclaimer: from here - None    | Email:     <[unmask]>
        --- .sig? ----- .what?  Who me?

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay Special Alert: Bronson Volume 4!!
From: Simon Furey <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 18:15:35 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(4 lines)


Surprise, surprise...I'm going for this...among a few score other people I
guess...
Thanks for the heads-up, Dolores
Simon

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 14:44:00 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(63 lines)


Any idea of what the total cost would be?
Norm----- Original Message -----
From: "edward cray" <[unmask]>
To: <[unmask]>
Sent: Thursday, September 11, 2003 8:45 AM
Subject: Re: Blaikie MS (NLS MS.1578)> Folks:
>
> I wonder how many list members might join me in underwriting a portion of
Jack's expenses/time.  He has access to manuscripts most of us would
otherwise never see.
>
> Ed
>
>
> ----- Original Message -----
> From: Jack Campin <[unmask]>
> Date: Thursday, September 11, 2003 0:09 am
> Subject: Re: Blaikie MS (NLS MS.1578)
>
> > > This is very valuable, especially as it early dates the tunes given.
> > > Motherwell printed some of the tunes, but is there any effort afoot
> > > to print the entire manuscript?
> >
> > Not unless I do it, I guess.  I had in mind publishing a few Scottish
> > MSS on CD-ROM using the same technology I've already used, but hadn't
> > thought of this one; it would be a couple of weeks' work and only
> > feasible if I could find some funding for it, as it's hardly going to
> > sell in huge numbers.
> >
> >
> > > Can it be copied/Xeroxed/scanned?
> >
> > Yes, but it won't be cheap.  There are microfilms about; these will
> > lose the pencil annotations (you've got my transcriptions of them,
> > anyway) but the music calligraphy is clear enough for microfilming,
> > the binding lies flat, and I don't remember seeing a single correction
> > or ambiguous pitch that might need close-up physical examination to
> > sort out.
> >
> > www.nls.uk will give reprographic prices somewhere.  Since they've
> > already microfilmed it, second-generation copies might be cheaper.
> >
>
> --------------------------------------------------------------------------
-
> > --
> > Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131
6604760
> > <" target="l">http://www.purr.demon.co.uk/jack>     *     food
intolerance
> > data & recipes,
> > Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro,
Embro".
> > ---> off-list mail to "j-c" rather than "ballad-l" at this site, please.
<-
> > --
> >
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: edward cray <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 17:20:08 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(80 lines)


Norm:I do not.  So far, I have noted five people willing to part with hard currency for such a CD: Dick Greenhaus, Paul Stamler, Bruce Olson, Lani Herrman and myself.  You would be the sixth.Note that I am asking Jack directly -- as well as tickling the ballad-l list once more.  Hey, you shake the tree and you never know what will fall out.Ed----- Original Message -----
From: Norm Cohen <[unmask]>
Date: Friday, September 12, 2003 2:44 pm
Subject: Re: Blaikie MS (NLS MS.1578)> Any idea of what the total cost would be?
> Norm
>
> ----- Original Message -----
> From: "edward cray" <[unmask]>
> To: <[unmask]>
> Sent: Thursday, September 11, 2003 8:45 AM
> Subject: Re: Blaikie MS (NLS MS.1578)
>
>
> > Folks:
> >
> > I wonder how many list members might join me in underwriting a portion of
> Jack's expenses/time.  He has access to manuscripts most of us would
> otherwise never see.
> >
> > Ed
> >
> >
> > ----- Original Message -----
> > From: Jack Campin <[unmask]>
> > Date: Thursday, September 11, 2003 0:09 am
> > Subject: Re: Blaikie MS (NLS MS.1578)
> >
> > > > This is very valuable, especially as it early dates the tunes given.
> > > > Motherwell printed some of the tunes, but is there any effort afoot
> > > > to print the entire manuscript?
> > >
> > > Not unless I do it, I guess.  I had in mind publishing a few Scottish
> > > MSS on CD-ROM using the same technology I've already used, but hadn't
> > > thought of this one; it would be a couple of weeks' work and only
> > > feasible if I could find some funding for it, as it's hardly going to
> > > sell in huge numbers.
> > >
> > >
> > > > Can it be copied/Xeroxed/scanned?
> > >
> > > Yes, but it won't be cheap.  There are microfilms about; these will
> > > lose the pencil annotations (you've got my transcriptions of them,
> > > anyway) but the music calligraphy is clear enough for microfilming,
> > > the binding lies flat, and I don't remember seeing a single correction
> > > or ambiguous pitch that might need close-up physical examination to
> > > sort out.
> > >
> > > www.nls.uk will give reprographic prices somewhere.  Since they've
> > > already microfilmed it, second-generation copies might be cheaper.
> > >
> >
> > -------------------------------------------------------------------------
> -
> -
> > > --
> > > Jack Campin: 11 Third Street, Newtongrange, Midlothian EH22 4PU; 0131
> 6604760
> > > <" target="l">" target="l">http://www.purr.demon.co.uk/jack>     *
> foodintolerance
> > > data & recipes,
> > > Mac logic fonts, Scots traditional music files, and my CD-ROM "Embro,
> Embro".
> > > ---> off-list mail to "j-c" rather than "ballad-l" at this site, please.
> <-
> > > --
> > >
> >
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Blaikie MS (NLS MS.1578)
From: Norm Cohen <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Fri, 12 Sep 2003 23:08:01 -0700
Content-Type:text/plain
Parts/Attachments:

text/plain(25 lines)


OK, keep me (us) posted.  And keep your umbrella handy.
Norm----- Original Message -----
From: "edward cray" <[unmask]>
To: <[unmask]>
Sent: Friday, September 12, 2003 5:20 PM
Subject: Re: Blaikie MS (NLS MS.1578)> Norm:
>
> I do not.  So far, I have noted five people willing to part with hard
currency for such a CD: Dick Greenhaus, Paul Stamler, Bruce Olson, Lani
Herrman and myself.  You would be the sixth.
>
> Note that I am asking Jack directly -- as well as tickling the ballad-l
list once more.  Hey, you shake the tree and you never know what will fall
out.
>
> Ed
>
>
>
>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay Special Alert: Bronson Volume 4!!
From: Dave Eyre <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 13 Sep 2003 11:26:36 +0100
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


<snip>his listings</snip>I have bought a number of the books from this person.He is a she Dolores!!Regards,Dave

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Lusty Beggars
From: Bruce Olson <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 13 Sep 2003 18:25:57 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(27 lines)


Prof. Child, ESPB, gave as his #279 the Scottish ballad, "The
Jolly Beggar", which I've added to the earlier (and un expurgated) "The
Politick
Beggar-Man" text in the Scarce Songs 1 file on my website.In it the young woman was seduced by the beggar, and when he is
ready to leave, he leaves her money for the nurses fee, then off
he starts with his four-and-twenty belted knights
In my notes there you will find reference to a traditional
sequel, where the four-and-twenty are 'jugglers' (ghiberlain =
beggar, gaberlunzie) first published in 1997.I've added an ABC of the tune "The Beggars Meal Pokes" from J.
Oswald's CPC, c 1758. Oswald attributed the tune to King James
6th.In Walsh's 'British Musical Miscellany', I, p. 50, [1734],
we find "The Gaberlunzie Man" tune attributed to King James 5th.
The usual tune for "The Gaberlunzie Man" has now turned up in the
Balcarres Lute MS, c 1700, so the song and tune are a little
older than previously thought.Bruce Olson
Roots of Folk: Old British Isles popular and folk songs, tunes,
and broadside ballads at my no-spam website
<A href="http://www.erols.com/olsonw"> Click here for homepage (=
subject index) </a>

Original Message:  

Permalink




--

LISTSERV 15.5 - BALLAD-L Archives

View:

Next Message | Previous Message


Options:

Reply


Subject: Re: Ebay Special Alert: Bronson Volume 4!!
From: "Lisa - S. H." <[unmask]>
Reply-To:Forum for ballad scholars <[unmask]>
Date:Sat, 13 Sep 2003 19:07:37 -0400
Content-Type:text/plain
Parts/Attachments:

text/plain(10 lines)


At 11:26 AM 9/13/03 +0100, you wrote:>He is a she Dolores!!If he is a she Dolores, then is she a He Dolores??I'm getting confused....
Lisa

Original Message:  

Permalink




--